KEGG   Escherichia coli P12b: P12B_c3663Help
Entry
P12B_c3663        CDS       T02030                                 

Gene name
bcsA
Definition
(GenBank) UDP-forming cellulose synthase catalytic subunit
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
elp  Escherichia coli P12b
Pathway
elp00500  Starch and sucrose metabolism
elp01100  Metabolic pathways
elp02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    P12B_c3663 (bcsA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    P12B_c3663 (bcsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:elp01003]
    P12B_c3663 (bcsA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elp02000]
    P12B_c3663 (bcsA)
Enzymes [BR:elp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     P12B_c3663 (bcsA)
Glycosyltransferases [BR:elp01003]
 Polysaccharide
  Structural polysaccharide
   P12B_c3663 (bcsA)
Transporters [BR:elp02000]
 Other Transporters
  Others
   P12B_c3663 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: AFG42481
LinkDB All DBs
Position
complement(3993858..3996476)
Genome map
AA seq 872 aa AA seqDB search
MSILTRWLLIPPVNARLIGRYRDYRRHGASAFSATLGCFWMSLAWIFIPLEHPRWQRIRA
EHKNLYPHINASRPRPLDPVRYLIQTCWLLIGASRKETPKPRRRAFSGLQNIRGRYHQWM
NELPERVSHKTQHLDEKKELGHLSAGARRLILGIIVTFSLILALICVTQPFNPLAQFIFL
MLLWGVALIVRRMPGRFSALMLIVLSLTVSCRYIWWRYTSTLNWDDPVSLVCGLILLFAE
TYAWIVLVLGYFQVVWPLNRQPVPLPKDMSLWPSVDIFVPTYNEDLNVVKNTIYASLGID
WPKDKLNIWILDDGGREEFRQFAQNVGVKYIARTTHEHAKAGNINNALKYAKGEFVSIFD
CDHVPTRSFLQMTMGWFLKEKQLAMMQTPHHFFSPDPFERNLGRFRKTPNEGTLFYGLVQ
DGNDMWDATFFCGSCAVIRRKPLDEIGGIAVETVTEDAHTSLRLHRRGYTSAYMRIPQAA
GLATESLSAHIGQRIRWARGMVQIFRLDNPLTGKGLKFAQRLCYVNAMFHFLSGIPRLIF
LTAPLAFLLLHAYIIYAPALMIALFVLPHMIHASLTNSKIQGKYRHSFWSEIYETVLAWY
IAPPTLVALINPHKGKFNVTAKGGLVEEEYVDWVISRPYIFLVLLNLVGVAVGIWRYFYG
PPTEMLTVVVSMVWVFYNLIVLGGAVAVSVESKQVRRSHRVEMTMPAAIAREDGHLFSCT
VQDFSDGGLGIKINGQAQILEGQKVNLLLKRGQQEYVFPTQVARVMGNEVGLKLMPLTTQ
QHIDFVQCTFARADTWALWQDSYPEDKPLESLLDILKLGFRGYRHLAEFAPSSVKGIFRV
LTSLVSWVVSFIPRRPERSETAQPSDQALAQQ
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcctgacccggtggttgctaatcccgccggtcaacgcgcggctgatcgggcgt
tatcgcgattatcgtcgccacggtgcgtcggctttcagcgcgacgctcggctgtttctgg
atgagcctggcctggatttttattccgctggagcacccgcgctggcagcgtattcgcgca
gaacataaaaacctgtatccgcatatcaacgcctcgcgtccgcgtccgctggacccggtc
cgttatctcattcaaacatgctggttattgatcggtgcatcgcgcaaagaaacgccgaaa
ccgcgcaggcgggcattttcaggtctgcaaaatattcgtggacgttaccatcaatggatg
aacgagctgcctgagcgcgttagccataaaacacagcatcttgatgagaaaaaagagctc
ggtcatttgagtgccggggcgcggcggttgatcctcggtatcatcgtcaccttctcgctg
attctggcgttaatctgcgttactcagccgtttaacccgctggcgcagtttatcttcctg
atgctgctttggggggtagcgctgatcgtacggcggatgccggggcgcttctcggcgcta
atgttgattgtgctgtcgctgaccgtttcttgccgttatatctggtggcgttacacctct
acgctgaactgggacgatccggtcagcctggtgtgcgggcttattctgctcttcgctgaa
acgtacgcgtggattgtgctggtgctcggctacttccaggtagtatggccgctgaatcgt
cagccggtgccattgccgaaagatatgtcgctgtggccgtcggtggatatctttgtcccg
acttacaacgaagatctcaacgtggtgaaaaataccatttacgcctcgctgggtatcgac
tggccgaaagataagctgaatatctggatccttgatgacggcggcagggaagagtttcgc
cagtttgcgcaaaacgtgggggtgaaatatatcgcccgcaccactcatgaacatgcgaaa
gcaggcaacatcaacaatgcgctgaaatatgccaaaggcgagttcgtgtcgattttcgac
tgcgaccacgtaccaacgcgatcgttcttgcaaatgaccatgggctggttcctgaaagaa
aaacagctggcgatgatgcagacgccgcaccacttcttctcaccggacccgtttgaacgc
aacctggggcgttttcgtaaaacaccgaacgaaggcacgctgttctatggtctggtgcag
gatggcaacgatatgtgggacgccactttcttctgcggttcctgtgcggtgattcgtcgt
aagccgctggatgaaattggcggcattgctgtcgaaaccgtgactgaagatgcgcatact
tctctgcggttgcaccgtcgtggctatacctccgcgtatatgcgtattccgcaggcggcg
gggctggcgaccgaaagtctgtcggcgcatatcggtcagcgtattcgctgggcgcgcggg
atggtacaaatcttccgtctcgataacccgctcaccggtaaagggctgaagtttgctcag
cggctatgttacgtcaacgccatgttccacttcttgtcgggcattccacggctgatcttc
ctgactgcgccgctggcgttcctgctgcttcatgcctacatcatctatgcgccagcgttg
atgatcgccctattcgtgctgccgcatatgatccatgccagcctgaccaactccaagatc
cagggcaaatatcgccactctttctggagtgaaatctacgaaacggtgctggcgtggtat
atcgcaccaccgacgctggtggcgctgattaacccgcacaaaggcaaatttaacgtcacc
gccaaaggtggactggtggaagaagagtacgtcgactgggtgatctcgcggccctacatc
ttccttgtcctgctcaacctggtgggcgttgcggtaggcatctggcgctacttctatggc
ccgccaaccgagatgctcaccgtggtcgtcagtatggtgtgggtattctacaacctgatt
gttcttggcggcgcagttgcggtatcggtagaaagcaaacaggtacgccgatcgcaccgc
gtggagatgacgatgcccgcggcaattgcccgcgaagatggtcacctcttctcgtgtacc
gttcaggatttctccgacggtggtttggggatcaagatcaacggtcaggcgcagattctg
gaagggcagaaagtgaatctgttgcttaaacgcggtcagcaggaatacgtcttcccgacc
caggtggcgcgcgtgatgggtaatgaagttgggctgaaattaatgccgctcaccacccag
caacatatcgattttgtgcagtgtacgtttgcccgtgcggatacatgggcgctctggcag
gacagctatccggaagataagccgctggaaagtctgctggatattctgaagctcggcttc
cgtggctaccgccatctggcggagtttgcgccttcttcggtgaagggcatattccgtgtg
ctgacttctctggtttcctgggttgtatcgtttattccgcgccgcccggagcggagcgaa
acggcacaaccatcggatcaggctttggctcaacaatga

DBGET integrated database retrieval system