KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_111476Help
Entry
Ga0102493_111476  CDS       T04740                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
elq  Erythrobacter litoralis DSM 8509
Brite
KEGG Orthology (KO) [BR:elq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ga0102493_111476
Enzymes [BR:elq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Ga0102493_111476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 HI0933_like K_oxygenase Thi4 NAD_binding_8 AlaDh_PNT_C DAO FAD_binding_3 Spermine_synth FMO-like
Motif
Other DBs
NCBI-ProteinID: AOL22504
UniProt: A0A074N2Y1
LinkDB All DBs
Position
complement(561636..563225)
Genome map
AA seq 529 aa AA seqDB search
MLDQNMKAQLGQYLANLRQPIELVATLDDGEKSAQTRELLEEIAALHDLVTARFDGTEGR
VPSFLIRRADDHASAVRFAGLPMGHEFTSLVLALLWAGGHPPKVDADLIEQVRGLEGQFD
FEMFFSLTCHNCPDVVQALTLMALENPNVTATLVEGGTFKDEVEERDILAVPATFLNGEV
FYNGKMELAEILSKVDTGADAKAAAKLSAKDPFEVLIVGGGPAGAAAAVYTARKGFRTGI
AAERFGGQLMDTLGIENLPGTTYTEGPKLTDNLRAQVGEYDIDVMDLAQAKSLRPAAEKG
GMHALELTNGAVLKGRALILATGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLANIVGHVTLIEFDTKLRADEVLQKKLRSMDNVEIIVNGQTTEITGD
GKRVNGLVLKDRESGEDRTIELEGVFIQIGLVPNTEWLKDTGIELSKYGEIVVDEHGSTS
LPGIYAAGDATIIKDKQIVVAMGTGATAGLGAFDYLIRNEPVEEIAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaccagaacatgaaggcccagcttgggcagtatcttgcaaacctgcgccagccg
atcgagctggtcgccactctcgacgatggcgagaagagcgcgcagacccgcgagttgctc
gaagaaatcgccgcgctccacgacctcgtcaccgcgcgtttcgacggcaccgagggccgc
gtgccgagcttcctcatccgccgcgccgatgaccacgcctccgcggtgcggttcgccggc
ctgccgatgggccatgaattcaccagcctcgtgctcgccctgctgtgggccggcggccac
ccgcccaaggtcgatgccgacctgatcgaacaggtgcgcggcctcgaagggcagttcgat
ttcgagatgttcttctcgctcacctgccacaactgccccgacgtggtgcaggcgctgacg
ctgatggcgctcgagaacccgaacgtcaccgcaaccctggtcgaaggcggcacgttcaag
gacgaggtcgaagaacgcgacatcctcgcggtgccggcgacctttctcaacggagaggtc
ttctacaacggcaagatggaactcgccgaaatcctgtccaaagtcgacaccggcgccgat
gccaaggcggcggccaagctttcggcgaaggacccgttcgaggtcctgatcgtcggcggc
ggcccggcgggcgcggcggcggcggtctataccgcgcgcaagggtttccgtaccgggatc
gcggccgaacgtttcggcggacagctgatggacacgctcgggatcgagaacctgcccggc
acgacctacaccgaaggccccaagctgaccgacaacctgcgcgcgcaggtcggcgaatac
gacattgacgtgatggacctcgcgcaggccaagtcgctccgcccggcggcggaaaagggc
ggcatgcacgcgctcgaactgaccaatggcgccgtgctcaagggccgcgcgctgattctc
gccacgggtgcacgctggcgcaacctgggcgttccgggcgaagccgaataccgcaacaag
ggcgttgcctattgcccccactgcgacggcccgctgttcaagggcaagcggatcgcggtg
atcggcggcggcaattcgggcgtcgaagcggcgatcgaccttgccaacatcgtcggccac
gtcaccctgatcgaattcgacaccaagctgcgcgccgacgaggtcctgcagaagaaactg
cgctcgatggacaatgtcgaaatcatcgtgaacggccagacgaccgagatcaccggtgac
ggaaagcgcgtcaacggcctcgtcctcaaggaccgcgagagcggcgaggaccgcacgatc
gaactcgagggcgtgttcatccagatcggcctcgtgcccaataccgaatggttgaaggac
acggggatcgaactgtcgaaatacggcgagatcgtcgtcgacgaacatggctctaccagc
ctgcccggcatctatgccgcaggcgatgcgacgatcatcaaggacaaacagatcgtcgtc
gccatgggcaccggtgcgaccgcaggcctcggcgcgttcgactatctcatccgcaatgag
ccggtcgaggagatcgcgcaggcggcgtag

DBGET integrated database retrieval system