KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_111820Help
Entry
Ga0102493_111820  CDS       T04740                                 

Definition
(GenBank) light-independent protochlorophyllide reductase subunit L
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00860  Porphyrin and chlorophyll metabolism
elq01100  Metabolic pathways
elq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ga0102493_111820
Enzymes [BR:elq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Ga0102493_111820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 MipZ AAA_26 AAA_16 AAA_25 NB-ARC SRP54 CBP_BcsQ RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AOL22842
UniProt: A0A074N4D6
LinkDB All DBs
Position
complement(940503..941399)
Genome map
AA seq 298 aa AA seqDB search
MNLHNPKSSFTPPDGEGSVQVQMDPRDEIKGAKVFAVYGKGGIGKSTTSSNLSAAFSKLG
HRVLQIGCDPKHDSTFTLTKKLMPTVIDVLETVEFHSEELRPEDYMFEGYNGVMCVEAGG
PPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVIFDVLGDVVCGGFAAPLQHAERALVVAAN
DFDSIFAMNRIVAAIGAKSKNYEVRLAGVVANRSRETDEIDRFCDKIGMERLAHFRDVDA
IRRSRLKKCTLFEMGDDPEVIEAQNEYLRLAQQLWDGVEPQLANPMKDREIFDFLGFE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcacaaccccaaatccagcttcaccccgcccgacggggaaggctcggtccag
gtccagatggacccgcgcgacgaaatcaagggcgcgaaggtcttcgccgtctatggcaag
ggcgggatcggcaagtcgacgacctcgtcgaacctgtcggcggcgttttccaagctcggc
caccgcgtgctgcagatcggttgcgatccgaagcatgacagcaccttcacgctgaccaag
aaactgatgccgacggtcatcgacgtactcgagacggtcgagttccattccgaggaactc
aggcccgaagactacatgttcgaaggctataacggcgtcatgtgcgtcgaggcgggcggc
ccgcctgcaggcacgggctgcggcggctatgtcgtcggccagacggtcaagctgctgaaa
cagcaccacctgctcgaggacaccgatgtcgtcatcttcgacgttctgggcgacgtcgtt
tgcggcggctttgccgccccgctccagcatgccgagcgcgcgctggtcgtcgccgcgaac
gatttcgacagcatcttcgcgatgaaccggatcgttgccgcgatcggcgccaagtccaag
aactacgaagtccgacttgctggcgtcgtcgccaatcgcagccgcgaaaccgacgagatc
gatcgcttctgtgacaagatcgggatggagcgccttgcccatttccgcgatgtcgatgcg
atccgccgctcgcgcctcaagaaatgcacgcttttcgagatgggcgacgatcccgaggtg
atcgaggcccagaacgaatatctcaggctcgcccagcagttgtgggacggtgtcgaaccg
cagctggcgaacccgatgaaggaccgtgaaatcttcgacttcctgggatttgaatga

DBGET integrated database retrieval system