KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_112825Help
Entry
Ga0102493_112825  CDS       T04740                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00620  Pyruvate metabolism
elq00680  Methane metabolism
elq01100  Metabolic pathways
elq01120  Microbial metabolism in diverse environments
elq01200  Carbon metabolism
Module
elq_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:elq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ga0102493_112825
  09102 Energy metabolism
   00680 Methane metabolism
    Ga0102493_112825
Enzymes [BR:elq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ga0102493_112825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AOL23830
UniProt: A0A074NLQ9
LinkDB All DBs
Position
1951799..1954465
Genome map
AA seq 888 aa AA seqDB search
MASRSPVQQNPDIRFLGKLLGDVIREHGGERLFERTEEIRRASIDRHRGEDIADLGLEKL
DLDETLAFVRGFGLFSMLANLAEDRAAPVAEGASDLASALRMLEEDGISREDVARLLENA
LIAPVLTAHPTEVRRKSVLDHRAAIARLMQERDAANGAAEPADAVETAIARQIALLWHTR
TLRRDRLYVTDEVDNAIDVMREVFLPVLPTLFERWESALGRELPGFIRLGSWIGGDRDGN
PHVTAGSLDYALSRAARLVIGAYLDAVHDLGAELSISSELAPVDPALEALAEASGDTSAH
RRDEPYRRALAGIYARLAATYRELTATDPPRAPVAERPAYASPEELLGELETIAAALERL
GGAGLASGDGLARLIRTVRLFGFHLATLDLRQNSAVHERVVAEMLAAAGVEEDYAALDEE
ERIAVLRGELAEARPLRISWHDYSEETTGELEIIDAVARAHRRFGAAAVTQYIVSMATSV
SDLLEVLVLLREAGLYRPGERAECPVMPVPLFETIGDLEAAPAIMREALALPELADLAGT
RGFQEVMLGYSDSNKDGGYLTSSWHLASASEALGKVFAEAGVTMQLFHGRGGSVGRGGGS
AFDAIRGQPRGTVNARIRITEQGEVIAAKYGSRDNAARNLEAIASATVLATLEPERIAPS
DAQRFASAMGEISRTAFGAYRALVYETEGFVDLFRQMTPIAEIAGLKIGSRPASRKGTDR
IEDLRAIPWVFSWSQARVMLPGWYGVGHALDAFDDKGLLRAMAREWPFFRNALANMEMVL
AKSDMGIARQYALLAEDSALAQRIFPRIEKGWSLTHDGLLEATGQSYLLEHSPQLDASIR
LRLPYIEPLNLLQVELLRRHRSGEDDPRIAEGIQLSINAIATALRNSG
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
ttggcgagtcgttccccggtccagcagaatccggacatccgctttctcggcaagctgctg
ggcgacgtgatccgcgagcatggcggcgagcgcctgttcgagcggaccgaggaaattcgc
cgcgccagcatcgaccgccatcggggcgaggacatcgcggacctcgggctcgaaaagctc
gatctcgatgagacgctcgcgttcgtgcgcggtttcgggctgttctcgatgctcgccaat
ctcgccgaggatcgcgcggcgcccgtcgccgaaggggcaagtgatctcgcctcggcgctg
cggatgcttgaagaggacggcatctcgcgcgaggatgtcgcgcggctgctcgaaaacgcg
ctgatcgccccggtgctgaccgctcatccgaccgaggtgcggcgcaagagcgtgctcgat
caccgcgccgccattgcccggctgatgcaggagcgtgacgcggcaaacggggcagccgag
ccggcggacgcggtcgagacggcgatcgcccgccagatcgcgcttttgtggcacacccgc
acgctgcgccgcgaccggctctacgtcaccgacgaagtcgacaacgcgatcgacgtaatg
cgcgaagtattccttcccgttctgcccaccctcttcgaacgctgggaaagcgcgctcggg
cgcgagcttccggggttcatccggctcggcagctggatcggcggagaccgcgacggtaac
ccccatgtcaccgccgggtcgctcgattacgcgctctcgcgcgccgcgcggctggtgatc
ggggcctatctcgacgcggtccatgatctcggcgcggagctttcgatctcgagcgagctt
gccccggtcgaccccgcactcgaagcgcttgcggaggcaagcggcgatacgtccgcccat
cgccgggacgagccctatcgccgcgcgctcgccgggatctatgcccggcttgcggcaacc
taccgcgaactcaccgcaaccgacccgccgcgcgccccggtggcggagcggccggcctat
gcctctcccgaggagcttctcggcgaactggagaccatagccgccgcgcttgaaaggctg
gggggtgcgggacttgccagcggcgacgggctcgcccggctgatccgtaccgttcggctg
ttcgggtttcacctcgccacgctcgacctcaggcagaacagcgcggtgcacgaacgcgtc
gtcgccgaaatgctcgccgctgccggggtcgaggaggattacgctgccctggacgaggag
gagcgcatcgcggtcctgcgcggcgaacttgccgaagcgcgcccgctgcgcatttcgtgg
cacgattattccgaggagacgaccggcgagctcgagatcatcgacgcggtcgcgcgcgcg
catcgccgcttcggcgcggcggcggtcacgcaatatatcgtttcgatggcgacgagcgtt
tcggaccttctcgaagttctcgtcctgctgcgcgaagcgggactctaccgcccgggcgag
cgggcggaatgccccgtcatgccggtccccctgttcgagacgatcggcgacctcgaagct
gcgcccgcgatcatgcgagaggcgctggccctccccgaacttgccgacctcgcgggcacg
cgggggttccaggaagtgatgctgggctattcggattcgaacaaggacgggggctatctc
acctcctcctggcatctcgccagcgcgagcgaggccttgggcaaggtctttgccgaggcg
ggcgtcaccatgcagctctttcacgggcgcggcgggtcggtcgggcgcggcggaggctcg
gccttcgatgcgatccgcggccagccgcgcggcaccgtgaacgcgcgcatccggattacc
gaacagggcgaggtgatcgcggccaaatacggcagccgcgacaatgccgcgcgcaacctt
gaagccatcgcaagcgcgaccgtgctcgcaacgctcgaaccggaacggatcgcgccctcc
gacgcgcagcgtttcgcatcggcgatgggggagatctcccgcaccgctttcggggcctat
cgcgcactcgtttacgagaccgaaggctttgtcgatctcttccgccagatgaccccgatc
gccgagatagcggggctgaagatcggcagccgcccggcgagccgcaagggcaccgaccgc
atcgaggacctgcgcgcgattccgtgggtgttttcctggagccaggcgcgtgtgatgctg
ccgggctggtacggggtcggccacgcgctcgatgccttcgacgacaagggcctgctgcgt
gccatggcccgggaatggccattcttcaggaacgcgctcgccaacatggaaatggtgctg
gcgaaatccgacatggggattgcacgacaatacgccctgctggccgaggacagcgccctg
gcgcagcgcatcttcccgcgcatcgagaaaggctggagcctgacccatgatgggctgctg
gaagcgacgggacagagctatctgctcgaacattcgccccagctcgacgcctcgatccgg
ctgcggctgccctatatcgaaccgctgaacctgctgcaggtcgaattgctgcgccgccac
cgcagcggcgaggacgatccgcgcatcgccgaaggcatccagctctcgatcaacgccatc
gcgaccgcacttcgcaacagcggctga

DBGET integrated database retrieval system