KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_113102Help
Entry
Ga0102493_113102  CDS       T04740                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:elq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ga0102493_113102
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elq02000]
    Ga0102493_113102
Enzymes [BR:elq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Ga0102493_113102
Transporters [BR:elq02000]
 Other Transporters
  Pores ion channels [TC:1]
   Ga0102493_113102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AOL24099
UniProt: A0A074N4P9
LinkDB All DBs
Position
2229257..2229892
Genome map
AA seq 211 aa AA seqDB search
MAEFTFYTVAMSRGQISRWALHEAGADYDDVVFNWDSKPANYADINPMGKVPALVHHHAD
DSGGHDHTVTECAAINHYLAETHPGAGLLPDTHERAAYYRWLFFASGPLEQAIMARMMGW
EVPEGKDTTAGFGTLERTLDALDGWLSAHDFAAGSRFTMADTYVGSQFVWGLRFGSIPER
PSFRAYVERVIQRPAYAQANAIDARLIEATR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggccgaattcaccttctacaccgtggcgatgagccggggacagatatcccgctgggcg
ctgcacgaggcgggggcggactacgatgacgtcgtgttcaactgggacagcaagcccgcg
aactacgccgacatcaacccgatgggaaaggtcccggcgcttgtccaccatcacgccgac
gacagcgggggtcacgaccacacggtgacggagtgcgcggcgatcaaccattacctcgcc
gaaacgcatccgggtgcgggcctgcttcccgacacgcatgaacgcgcggcctattatcgc
tggctgttcttcgcgtcaggcccgctcgaacaggcgatcatggcgcggatgatgggctgg
gaagtgcccgaggggaaggacacgacggcgggtttcggcacgctcgaacgcacgctcgat
gcgctggacggctggctttcggcgcatgatttcgccgcaggctcgcgcttcaccatggcc
gacacctatgtcggcagccagttcgtctggggcctgcgctttggctcgatccctgaaaga
ccttcattcagggcctatgtcgaacgggtcatccagcggcccgcctatgcccaggccaac
gccattgatgcaaggctgatcgaggcgacgcgctag

DBGET integrated database retrieval system