KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_03775Help
Entry
ECO55CA74_03775   CDS       T02066                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Brite
KEGG Orthology (KO) [BR:elr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECO55CA74_03775
Enzymes [BR:elr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECO55CA74_03775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AEZ39370
LinkDB All DBs
Structure
PDB: 

Position
804770..806335
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKASLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNSLPV
RKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLEQIRHIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEG
GLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaactcaactcaaggcttcccttgagaaattgaccaagcct
gttgagttaattgccacgctggatgacagcgctaaatcggcagaaatcaaggaactgttg
gctgaaatcgcagaactgtcagacaaagtcacctttaaagaagataacagcttgccggtg
cgtaagccgtctttcctgatcaccaacccaggttctaaccaggggccacgttttgcaggc
tccccgctgggccacgagttcacctcgctggtactggcgttactgtggaccggtggtcat
ccgtcgaaagaagcgcagtctctgctggagcagattcgccatattgacggtgattttgaa
ttcgaaacctattactcgctctcttgccataactgcccggacgtggtacaggcgctgaac
ctgatgagcgtattgaacccgcgcatcaagcacactgcaattgacggcggcaccttccag
aacgagatcactgatcgtaacgtgatgggcgttccggcagtgttcgtgaacgggaaagag
tttggtcagggccgcatgactttgactgaaatcgttgccaaaattgatacgggcgcggaa
aaacgtgcggcagaagagctgaacaagcgtgatgcttatgacgtattaatcgtcggttcc
ggcccggcgggtgcagcggcagcaatttactccgcacgtaaaggcatccgtaccggtctg
atgggcgaacgttttggtggtcagatcctcgataccgttgatatcgaaaactacatttct
gtaccgaagactgaagggcagaagctggcaggcgcactgaaagttcacgttgatgaatac
gacgttgatgtgatcgacagccagagcgccagcaaactgatcccagcagcagttgaaggt
ggtctgcatcagattgaaacagcttctggcgcggtactgaaagcacgcagcattatcgtg
gcgaccggtgcaaaatggcgcaacatgaacgttccgggcgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggcccgctgtttaaaggtaaacgcgtagcggtt
atcggcggcggtaactccggcgtggaagcggcaattgacctggcgggtatcgttgagcac
gtaacgctgctggaatttgcgccagaaatgaaagccgaccaggttctgcaggacaaactg
cgcagcctgaaaaacgtcgacattattctgaatgcgcaaaccacggaagtgaaaggcgac
ggcagcaaagtcgttggtctggaatatcgagatcgtgtcagcggcgatattcacaacatc
gaactggccggtattttcgtgcagattggtctgctgccgaacaccaactggctcgaaggc
gcagtcgaacgtaaccgcatgggcgagattatcattgatgcgaaatgcgaaaccaacgtg
aaaggcgtgttcgcagcgggtgactgtacgacggttccgtacaagcagatcatcatcgcc
actggcgaaggtgccaaagcctctctgagtgcttttgactacctgattcgcaccaaaact
gcataa

DBGET integrated database retrieval system