KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_04850
Entry
ECO55CA74_04850   CDS       T02066                                 

Definition
(GenBank) hypothetical protein
  KO
K23656  T3SS secreted effector NleD
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-ProteinID: AEZ39579
LinkDB
Position
1019173..1019871
AA seq 232 aa
MRPTSLNLVLHQSSTSSSMSDTDIESLVKASSVQWIKNNPQLRFQGTDHNIYQQIEAALD
KIGSTETGRVLLNAIESISRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLN
AVEYPCGEGISVVDFHATIVFHELLHVFHNLNGERLKVESSRPESQKYSPLLLEEARTVG
LGAFSEEVLSENKFREEIGMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL
NT seq 699 nt   +upstreamnt  +downstreamnt
atgcgccctacgtccctcaacttggtattacatcagtcatcaacgtcgagctcaatgtca
gatacagatatcgagtctcttgtaaaagcatcgagcgttcaatggataaaaaataatccg
caacttcgtttccaggggactgatcataatatatatcagcagattgaagcagcactcgat
aagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaatatcccga
cttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatggcacat
agagatatagatgctgagaaccatcgggggactggttccgattttcactgtaatctgaat
gcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgactattgtt
tttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagttgagagt
tcccgaccagaatcacaaaaatactctccacttttactcgaagaagccaggactgttggg
ttgggggctttttcagaagaggtgctttcagaaaataaattccgcgaagagattgggatg
ccccgtagaacctcctacccgcacgactcagctcttattcatgatgacaatacagtgagt
ctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system