KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_05465Help
Entry
ECO55CA74_05465   CDS       T02066                                 

Definition
(GenBank) cysteine/glutathione ABC transporter membrane/ATP-binding component
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:elr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECO55CA74_05465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elr02000]
    ECO55CA74_05465
Transporters [BR:elr02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    ECO55CA74_05465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N AAA_22 DUF87 AAA_16 NACHT MMR_HSR1 RsgA_GTPase FtsK_SpoIIIE AAA_29 AAA_30 T2SSE Rad17 AAA_23 AAA_5
Motif
Other DBs
NCBI-ProteinID: AEZ39700
LinkDB All DBs
Position
complement(1149108..1150829)
Genome map
AA seq 573 aa AA seqDB search
MRALLPYLALYKRHKWMLSLGIVLAIVTLLASIGLLTLSGWFLSASAVAGVAGLYSFNYM
LPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELL
NRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDSTLAFTLGGIMLLTLFLMPPL
FYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQ
SELTALSQAIMLLIGALAVILMLWMASGGVGGNAQPGALIALFVFCALAAFEALAPVTGA
FQHLGQVIASAVRISDLTDQKPEVTFPDTQTRVADRVSLTLRDVQFTYPEQSQQALKGIS
LQVNAGEHIAILGRTGCGKSTLLQLLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVP
QRVHLFSATLRDNLLLASPGSSDEALAVILRRVGLEKLLEDAGLNSWLGEGGRQLSGGEL
RRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMREKTVLMVTHRLRGLSRFQ
QIIVMDNGQIIEQGTHAELLARQGRYYQFKQGL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgctttgctaccctatctggcactgtataaacgtcataaatggatgttaagtctt
ggtattgtgctggcaattgtgacgctgctcgccagtatcggtctgttgacactttccggc
tggttcctctcggcctcagcggttgcgggggttgccggactgtacagcttcaactatatg
ctacccgctgcgggcgtgcgtggtgcagcaatcacccgtactgccgggcgttattttgaa
cgtctggtaagtcacgacgcgactttccgcgtgttgcagcatctgcgcatttacaccttc
agcaaattgttgcccctctcccctgccggactggcgcgctatcgtcagggcgaattgctc
aaccgcgtggtggcggatgttgatacgctcgatcatctttacctgcgcgttatctcgccg
ctggtgggcgcttttgtggtgattatggtggtgacaatcgggttaagtttccttgattcc
accctcgcctttacgctgggcggcattatgttactgacgcttttcctgatgccaccgctg
ttttatcgtgcgggaaaaagcaccgggcaaaatctgactcatcttcgcggacagtatcgc
caacaactgacggcctggctgcaagggcaagctgagctgaccatttttggtgccagcgat
cgttatcgcacgcaactagagaatacagaaattcaatggctggaagcgcaacgccgtcaa
tctgaactgaccgcattgtcgcaagcgataatgctgctcattggcgcgttagcggtgatc
ctgatgctgtggatggcgtctggcggcgttggcggcaatgctcaacccggcgcgttaatt
gccctgtttgtcttttgcgcgttagccgcgtttgaagcactggcaccagtaacgggtgca
tttcagcatctggggcaagtcattgcctctgccgtacgtatctctgacttaacggatcaa
aaaccggaggtcaccttccctgatacccaaactcgtgttgccgatcgcgtttcgctgaca
ttacgggatgttcagttcacttatccggagcaatcccaacaggcacttaaagggatttct
cttcaggtaaacgccggggaacatatagcgattctcgggcgaaccggatgcggcaaatca
acactgttacaactgctgacccgcgcatgggacccgcaacagggcgagattttgcttaac
gatagccccatagccagcctgaatgaagcggctctacgacagaccatcagcgttgttcct
cagcgagtgcatctgtttagcgccacgctgcgtgataatctgttactcgcctcgcctggc
agtagtgatgaggctctggcggtgatcttacgtcgcgttggtctggagaagctgctcgag
gatgcaggtctcaacagttggttaggtgaaggcggacgccagctctccggtggtgaactg
cgccgtctggctatcgcccgtgcgctgttacatgatgcgccactggtgttgctggatgaa
cctaccgaaggcttagatgccacaaccgaaagccagatccttgaattgcttgcagaaatg
atgcgtgagaaaacggtgttaatggtcacccatcgacttcgcggactctctcgtttccaa
caaataatagtgatggacaacgggcaaattattgagcaaggtactcacgcagaactgctt
gccagacaggggcgttattaccagttcaagcagggtttgtaa

DBGET integrated database retrieval system