Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_06605 Help Entry ECO55CA74_06605   CDS       T02066                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism elr  Escherichia coli O55:H7 RM12579 (EPEC) Pathway elr01100   Metabolic pathways elr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:elr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ECO55CA74_06605   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ECO55CA74_06605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 TerB DUF1493 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEZ39924 LinkDB All DBs Position 1402730..1402966 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaattatcggcgaacagctgggcgttaagcag gaagaagttaccaacaatgcttctttcgttgaagacctgggcgcggattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system