KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_10080Help
Entry
ECO55CA74_10080   CDS       T02066                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Brite
Enzymes [BR:elr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECO55CA74_10080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEZ40602
LinkDB All DBs
Structure
PDB: 

Position
2087049..2087630
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETIEYHYGKHHQTYVTNLNNLIKGTAFEGKSLEEIIRSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPTGKVAEAIAASFGSFADFKAQFTDAAIKNFG
SGWTWLVKNSDGKLAIVSTSNAGTPLTTDATPLLTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWEFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcattcgaattacctgcactaccatatgctaaagatgctctggcaccgcacatttct
gcggaaactatcgagtatcactacggcaagcatcatcagacttatgtcactaacctgaac
aacctgattaaaggtaccgcgtttgaaggtaaatcactggaagagattattcgcagctct
gaaggtggcgtattcaacaacgcagctcaggtctggaaccatactttctactggaactgc
ctggcaccgaacgccggtggcgaaccgactggaaaagtcgctgaagctatcgccgcatct
tttggcagctttgccgatttcaaagctcagtttactgatgcagcgatcaaaaactttggt
tctggctggacctggctggtgaaaaacagcgatggcaaactggctatcgtttcaacctct
aacgcgggtactccgctgaccaccgatgcgactccgctgctaaccgttgatgtctgggaa
cacgcatattacatcgactatcgcaatgcacgtcctggctatcttgagcacttctgggcg
ctggtgaactgggaattcgtagcgaaaaatctcgctgcataa

DBGET integrated database retrieval system