KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_10675Help
Entry
ECO55CA74_10675   CDS       T02066                                 

Definition
(GenBank) putative oxidoreductase
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 Cupin_2 TP_methylase ThiF
Motif
Other DBs
NCBI-ProteinID: AEZ40721
LinkDB All DBs
Structure
PDB: 

Position
complement(2210015..2211058)
Genome map
AA seq 347 aa AA seqDB search
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGTLVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGASAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcaaaagcaatattgcaggtgccgggcacaatgaaaattatttcagcagaa
ataccagtgcctaaagaagatgaagttttgattaaagtagaatatgtcggtatttgtggt
tcagatgtacatggttttgaatcaggtccgtttattccgcctaaagacccaaatcaagaa
attggcctgggtcatgaatgcgccgggacggttgtggctgtgggaagccgtgtgcgcaaa
tttaaaccgggggatcgggtaaatatcgaacctggcgttccttgcggtcactgtcgttac
tgtctggaaggcaaatataacatctgcccggacgttgattttatggcgacacaacccaac
taccgcggcgcattaacgcactatctgtgtcatccggagagctttacttacaaactgccc
gacaatatggacacgatggaagggacgctggtggagcctgccgcagtcgggatgcatgcc
gcgatgctggcagatgttaaaccgggtaagaagataattattctgggagcaggttgtatt
ggtttgatgacgttgcaagcgtgcaaatgcctgggagcaacggaaattgccgtcgttgat
gtgctggaaaaacgtctggcaatggcggaacagcttggtgcgacagtggttattaacggc
gcaaaagaagacactattgcacgctgtcagcaatttaccgaagacatgggcgcagatatt
gttttcgaaacagcgggttctgcggtcaccgttaaacaggcaccttatctggtaatgcgt
ggcggtaaaattatgattgttggtactgtacccggcgcttcggcaatcaatttcctcaaa
atcaatcgcgaagtcactatccagacggtattccgctatgccaatcgttatccggtcacg
attgaagcaatttcttcagggcgattcgatgtgaaatcgatggtgacgcatatttacgat
tatcgggatgtacaacaggcatttgaagagtcagttaacaacaaacgcgacattattaaa
ggcgttattaagattagcgattaa

DBGET integrated database retrieval system