KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_12625
Entry
ECO55CA74_12625   CDS       T02066                                 

Definition
(GenBank) galactitol-1-phosphate dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00052  Galactose metabolism
elr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECO55CA74_12625
Enzymes [BR:elr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     ECO55CA74_12625
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N Methyltransf_25 PrmA ELFV_dehydrog TrkA_N FAD_binding_2
Other DBs
NCBI-ProteinID: AEZ41105
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2594917..2595957)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQGVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFECFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgttgcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagcggctatattgatgcggtaggatccggtgttgatgatttacatcctggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtctgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcacggcgtgatggtggatttgccgaatat
attgtcgttaagcggaaaaatgtctttgctctacccacggatatgcctattgaggatggg
gcttttattgaaccgattaccgttggcctgcatgcttttcatttagcgcaaggttgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggctattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggcgatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagtagcgaaatgagcgcgccgcaaatg
cagggcgttttacgcgagctgcgctttaatcagcttatcctcgagacggctggcgtaccg
caaactgtggaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggg
acgttgcatcaggatctgcatttaacatcggcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaatgcttcgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system