KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_16440
Entry
ECO55CA74_16440   CDS       T02066                                 

Definition
(GenBank) hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00230  Purine metabolism
elr00240  Pyrimidine metabolism
elr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECO55CA74_16440
   00240 Pyrimidine metabolism
    ECO55CA74_16440
Enzymes [BR:elr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     ECO55CA74_16440
    3.2.2.-  
     ECO55CA74_16440
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AEZ41853
LinkDB
Structure
PDB: 
6GFL 6GFM

Position
3400847..3402211
AA seq 454 aa
MITHISPLGSMDMLSQLEVDMLKRTASSDLYQLFRNCSLAVLNSGSLTDNSKELLSRFEN
FDINVLRRERGVKLELINPPEEAFVDGRIIRALQANLFAVLRDILFVYGQIHNTVRFPNL
NLDNSVHITNLVFSILRNARALHVGEAPNMVVCWGGHSINENEYLYARRVGNQLGLRELN
ICTGCGPGAMEAPMKGAAVGHAQQRYKDSRFIGMTEPSIIAAEPPNPLVNELIIMPDIEK
RLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPANKDQVLPLILTGPKESADYFRVLD
EFVVHTLGENARRHYRIIIDDAAEVARQMKKSMPLVKENRRDTGDAYSFNWSMRIAPDLQ
MPFEPSHENMANLKLYPDQPVEVLAADLRRAFSGIVAGNVKEVGIRAIEEFGPYKINGDK
EIMRRMDDLLQGFVAQHRMKLPGSAYIPCYEICT
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgattacacatattagcccgcttggctccatggatatgttgtcgcagctggaagtggat
atgcttaaacgcaccgccagcagcgacctctatcaactgtttcgcaactgttcacttgcc
gtactgaactccggtagtttgaccgataacagcaaagaattgctgtctcgttttgaaaat
ttcgatattaacgtcttgcgccgtgaacgcggcgtaaagctggaactgattaatcccccg
gaagaggcttttgtcgatgggcgaattattcgcgctttgcaggccaacttgttcgcggtt
ctgcgagacattctcttcgtttacgggcaaatccataataccgttcgttttcccaacctg
aatctcgacaactccgtccacatcactaacctggtcttttccatcttgcgtaacgctcgc
gcactgcatgtgggtgaagcgccaaatatggtggtctgctggggcggtcactcaattaac
gaaaatgagtatttgtatgcccgtcgcgtcggaaaccagctgggcctgcgtgagctgaat
atctgcaccggctgtggtccgggagcgatggaagcgccgatgaaaggtgctgcggtcgga
cacgcgcagcagcgttacaaagacagtcgttttattggtatgacagagccgtcgattatc
gccgctgaaccgcctaacccgctggtcaacgaattgatcatcatgccggatatcgaaaaa
cgtctggaagcgtttgtccgtatcgctcacggcatcattatcttccctggcggtgtgggt
acggcagaagagttgctgtatttgctgggaattttaatgaacccggccaacaaagatcag
gttttaccattgatcctcaccggcccgaaagagagcgccgactacttccgcgtactggac
gagtttgtcgtacatacgctgggcgaaaacgcgcgccgccattaccgcataatcattgat
gacgccgctgaagtcgcccgtcagatgaaaaaatcgatgccgctggtgaaagaaaatcgc
cgtgatacaggcgatgcctacagctttaactggtcaatgcgcattgcgccagatttgcaa
atgccatttgagccgtctcacgagaatatggctaatctgaagctttacccggatcaacct
gttgaagtgctggctgccgatctgcgccgtgcgttctccggtattgtggcgggtaacgta
aaagaagtcggtattcgcgccattgaagagtttggtccttacaaaatcaacggcgataaa
gagattatgcgtcgtatggacgacctgctacagggttttgttgcccagcatcgtatgaag
ttgccaggctcagcctacatcccttgctacgaaatctgcacgtaa

DBGET integrated database retrieval system