KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_21135Help
Entry
ECO55CA74_21135   CDS       T02066                                 

Definition
(GenBank) espF
  KO
K12786  LEE-encoded effector EspF
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF DUF5535
Motif
Other DBs
NCBI-ProteinID: AEZ42777
LinkDB All DBs
Position
complement(4385323..4385637)
Genome map
AA seq 104 aa AA seqDB search
MAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEAL
GFKPARQAPPPPTSGQASGASRPLPPIAQALKDHLAAYEQSKKG
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
ttggctgcctatgaaaaatcgaaaggtcctgaggctttaggttttaagcccgcccgtcag
gcaccgccgccaccgacaagtggacaggcatccggggcatcccgacctttaccgcccatt
gcacaggcattaaaagagcacttggctgcctatgaaaaatcgaaaggtcctgaggcttta
ggttttaagcccgcccgtcaggcaccgccgccaccgacaagtggacaggcatccggggca
tcccgacctttaccgcccattgcacaggcattaaaagatcatttagctgcctatgagcaa
tcgaagaaagggtaa

DBGET integrated database retrieval system