KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_24150Help
Entry
ECO55CA74_24150   CDS       T02066                                 

Definition
(GenBank) D-alanine/D-serine/glycine permease
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Brite
KEGG Orthology (KO) [BR:elr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elr02000]
    ECO55CA74_24150
Transporters [BR:elr02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ECO55CA74_24150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2
Motif
Other DBs
NCBI-ProteinID: AEZ43367
LinkDB All DBs
Position
5042084..5043496
Genome map
AA seq 470 aa AA seqDB search
MVDQVKVVADDQAPAEQSLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVY
MIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVV
AITAYAQFWFPDLSDWVASLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGL
VMVAMHFQSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKD
PEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVIN
FVVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVV
MLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCW
VCMAFFVFVVVLLTLEDDTRQALLVTPLWFIALGLGWLFIGKKRAAELRK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggtagatcaggtaaaagtcgttgccgatgatcaggctccggctgaacagtcgctacgg
cgcaatctcacaaaccgacatattcagcttattgccattggtggtgccattggtacgggg
ttgtttatggggtctggcaaaacgattagccttgccgggccgtcgatcattttcgtttat
atgatcattggttttatgctctttttcgtgatgcgggcaatgggggaattgctgctttcg
aatctggaatacaaatcttttagtgacttcgcttccgatttactcgggccgtgggcagga
tatttcaccggctggacttactggttctgctgggttgtaaccggtatggcagacgtggtg
gcgatcacggcttatgctcagttctggttccccgatctctccgactgggtcgcctcgctg
gcggtgatagtgctgctgctgacgcttaacctcgccactgtgaaaatgttcggtgagatg
gagttctggtttgcgatgatcaaaatcgtcgccattgtgtcgctgattgtcgtcggcctg
gtcatggtggcgatgcactttcagtcaccgactggtgtggaagcgtcattcgcgcatttg
tggaatgacggcggctggttcccgaaaggtttaagtggcttctttgccggattccagata
gcggttttcgctttcgtggggattgagctggtaggtacaacagctgcggaaaccaaagat
ccagagaaatcactgccacgcgcgattaactccattccgatccgtatcattatgttctac
gtcttcgcgctgattgtgattatgtccgtgacgccgtggagttcggtagtcccggagaaa
agcccgtttgttgaactgtttgtgttggtaggtttgcctgcggctgccagcgtgatcaac
tttgtggtgctgacctctgcggcgtcttccgctaacagtggcgtcttctctaccagccgt
atgctgtttggtctggcgcaggaaggtgtggcaccgaaagcgttcgctaaactttctaag
cgcgcagtacccgcgaaagggttgactttctcgtgtatctgtctgctcggcggcgtggtg
atgttgtatgtgaatcctagcgtgattggcgcgttcacgatgattacaaccgtttccgcg
attctgtttatgttcgtctggacgattatcctttgctcgtaccttgtgtatcgcaaacag
cgtcctcatctacatgagaagtcgatctacaagatgccgctcggcaagctgatgtgctgg
gtatgtatggcgttctttgtgttcgtggtcgtgttgctgacactggaagatgacactcgc
caggcgctgctggttaccccgctgtggtttatcgcgctggggctgggctggttgtttatt
ggtaagaagcgggctgctgaactgcggaaataa

DBGET integrated database retrieval system