KEGG   Esox lucius (northern pike): 105005707
Entry
105005707         CDS       T04894                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
els04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105005707
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105005707
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:els04030]
    105005707
G protein-coupled receptors [BR:els04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    105005707
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx UPF0093
Other DBs
NCBI-GeneID: 105005707
NCBI-ProteinID: XP_012987508
LinkDB
AA seq 332 aa
MEGNCYNNETISFFYNRSGKNISKEWRTQDYVVVSLGLTVCIIVILANILVMVAIFTNRR
FHFPIYYLLGNLAAADLFAGISYLYLMFHTGPWTMKLSTQEWFLRQNLIDTSLTASVANL
LAIAVERHQTIFTMQLHSQMTNRRVILLISGIWATAIFMGMVPAMGWHCLCNLNSCSTMA
PMYSKSYLVFWAVLNLLTFFIMMAVYTRIFVYVRHKSQRMSQHTSETRQKETVVNLMKTV
SMILGCFVICWTPGLVLLMLDGMGCKSCQVLRFEKYCLVLAECNSLVNPIIYSFRDKEML
LTFKRILCCLCRRGNDRENTLSGVHFNTLEQE
NT seq 999 nt   +upstreamnt  +downstreamnt
atggaagggaactgttacaataacgagacgatcagtttcttctacaaccggagtggcaag
aacatcagcaaggaatggcggacgcaggactacgtggtggtgagcctcggcctcaccgtc
tgcatcattgtcatcctcgccaacatcctggtcatggtggccatcttcaccaaccgaaga
ttccacttccccatctactacctgttagggaacctggcggcagctgacctgtttgcgggt
atctcctacttgtatctgatgttccacactggaccctggacaatgaagctgtccacgcag
gagtggttcctccgccagaacctaatcgacaccagcctcacagcgtcggtggccaacctg
ctggccattgcggtcgagcgccaccagaccatcttcaccatgcagctccacagccagatg
actaaccggcgcgtgatcctcctgatctccgggatctgggccacagccatattcatgggc
atggtgccggcgatgggctggcactgcctgtgcaacctgaatagctgctccaccatggcg
cccatgtacagcaagtcctacctggtgttctgggccgtgctcaacctgctcaccttcttc
atcatgatggccgtgtacaccaggatcttcgtctatgtgcgacacaagagccagaggatg
tcccagcacacgtcagagacgcggcagaaggagactgtggtgaacctgatgaagactgtg
tccatgattctgggttgcttcgtgatctgctggacccctggcctggtgctgttgatgctg
gacggcatgggctgcaagtcatgccaggtcctgcgctttgagaagtactgcctcgtcctg
gcagagtgcaactccctggtcaaccccatcatctacagcttcagggacaaggagatgctg
ctgaccttcaagaggatcctctgctgtctctgtcgccgcgggaacgaccgggaaaacacg
ctgtccggcgtgcacttcaacaccctggagcaagagtga

DBGET integrated database retrieval system