KEGG   Esox lucius (northern pike): 105005964
Entry
105005964         CDS       T04894                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
els  Esox lucius (northern pike)
Pathway
els00230  Purine metabolism
els01100  Metabolic pathways
els04020  Calcium signaling pathway
els04114  Oocyte meiosis
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04371  Apelin signaling pathway
els04540  Gap junction
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105005964 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105005964 (adcy3)
   04020 Calcium signaling pathway
    105005964 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105005964 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105005964 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    105005964 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    105005964 (adcy3)
   04916 Melanogenesis
    105005964 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105005964 (adcy3)
   04270 Vascular smooth muscle contraction
    105005964 (adcy3)
Enzymes [BR:els01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105005964 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1053 OPA3
Other DBs
NCBI-GeneID: 105005964
NCBI-ProteinID: XP_010862547
UniProt: A0A3P8Z3B9
LinkDB
AA seq 1126 aa
MPRNRAFSEPEYSAEYSADCSVTLPSDPGQAVGRTHEVTVRSQGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYIIVMCAVVYTGDKLASVVVASVGLASDIL
LYVLCRYGLLPDRISRRVVPYALWVLIAAQIFCYLGLSYARFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITAVSCGVHTLVLGVTIAQQQQEDIQGAALGRQLLANIVIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKKEA
SQTGQKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAHELVKLLNELFARFDKLAA
KYHQLRIKILGDCYYCICGLPEYREDHAACSIMMGLAMVEAISYVREKTGTDVDMRVGVH
TGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQATMECLHGEFDMEPGNGG
DRCEYLKERGIDSYLVVVPKGPLAKSGINGVKLSVTSSNGNSPLLINTTDCNGSVHTACT
TPEEPEELDTRVVNPSFPNPRRRLRLRDLAERVIDAQENEQELNKLLNEALLERETVQAL
KGKHTNRLSLRFVDPDLETRYSVEKEKQSGAAFSCCCVVLLFTAAMEALIDPLVIANYVT
LAVGEILLLVLTVCSLAAIFPRVFPKRLVSFSTWIDHTRWARNTWAMAAIIILTMADIVD
MLSCLPPPGPSDNTTMSPPAFLLVQSGQEGCLENPKYYSYIAVLALMATTMLVQVSHMVK
VTLMLLITIATGIVNIYSWRDIFDRYDIARFQDYRSYLVPSKYAMTLMIFIMMISFYYFS
RHVEKLARTLFLWKIEVHDQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQ
SYDEIGVMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDESQFRCITKIKTI
GSTYMAASGVTPDVSNGYACLKKEELSDRERWQHLADLADFALAMKVTLMNINYQSFNNF
MLRIGLNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGF
RFVRRGPIFVKGKGELLTYFLKGREKQGSFINGSSVTLPHQVVDSS
NT seq 3381 nt   +upstreamnt  +downstreamnt
atgcctcgcaaccgggccttctcagagccggagtattcggcagagtattctgcagactgc
tcggtgaccctaccgtcggacccgggccaagctgtgggtcgcacacacgaggtgacggtt
cgaagccaaggatgctgcctctgtctcccacgcttcatgcgcctcacctttgcacctgag
tcactggaaaacctttatcagacatatttccggcgacagcggcacgaaaccctgctggtc
ctggttgtgtttgctgccctgtttgactgctacatcatcgtcatgtgtgctgtggtgtac
accggggacaagttggcctctgtggtagtggcttccgtgggcctagcatcagacatccta
ctctatgtgttgtgccgctacggtctgctaccggaccgcatctcacggcgcgtggtgccc
tacgccctgtgggtgctcatagcggcccagatcttttgctacctgggcctgagctatgcc
cgcttccaccaggccagcgacacggtgggctggcaggccttcttcagtttctccttcttc
ctgacactgcccctgcggctaaccccaatcgtgttgatcacagcagtgtcatgcggggtc
cacaccctggtgcttggggtcaccatagctcaacagcagcaggaggacatccagggggct
gcccttgggagacagctgctggccaacatcgtgatctatgtgtgtgccatcactgtgggg
gtcatgtcctactacatggctgaccggaaacaccgtaaggccttcctggaagcgcggcag
tccctggaggtcaaactgaatctggaggaacagagccagcaacaggagcgcctattgctg
tctatccttcccaagcacatagcagatgagatgttgcaggacatgaagaaaaaagaagca
agtcagactggacagaaggagatgcagcagtttaacaccatgtatatgtaccgtcacgaa
aacgtcagtattttgtttgcagacattgtgggattcacccagctgtcatcttcatgcagt
gcccatgagctggtcaagctcctcaatgaactgtttgcccgttttgacaagctggctgct
aaataccaccagctgagaataaagatcttgggggactgctactattgcatctgtggcctg
ccagaatacagggaggaccatgctgcctgctccatcatgatgggcctggccatggtggag
gccatctcgtatgtgcgggagaaaaccgggaccgatgtggacatgcgggttggggtacac
accggcaccgttctgggtggggtgctcgggcagaagcgttggcagtatgatgtttggtca
accgacgtcacagtcgccaacaagatggaggctggagggatacctgggcgtgtacacatc
tcacaggccaccatggagtgtctgcatggggagtttgacatggagcctgggaacgggggc
gaccgctgtgagtacctcaaggagaggggcatcgactcttacctggtggtagtgccgaaa
ggtcccctggcaaagagtggcatcaacggggtgaagctgtccgtgacatcatccaatggg
aactctccactgttaatcaacaccactgattgcaatgggagtgtccacacagcctgcacc
acaccagaagaacctgaggaattggacacacgggtagtgaacccttcgtttcccaaccca
cgacggaggctgagattgcgggacctggctgaacgggtgattgacgctcaggaaaatgaa
caggagctcaacaaactgctcaatgaggcactgctggagagagagactgtacaagctttg
aagggtaaacacaccaaccgtctgtccttgcgctttgtggaccctgacctggagacccgt
tactctgtagagaaggagaagcagagcggggctgccttcagctgctgctgtgtggtgctc
ctgttcactgctgccatggaggccctcatagaccccttggtgatcgcaaactacgtgacc
ctagcagtgggagagatcctgctgcttgtcctcaccgtctgctctctggcagccattttc
cctcgagtttttccaaagaggctggtgtctttctccacatggattgaccacactcgctgg
gcccggaacacatgggctatggcagccattatcattctcaccatggctgatattgtggac
atgctaagctgtctgccaccaccaggtccctcggacaacaccacaatgagccctcctgcc
ttcttgcttgttcaatctgggcaagagggctgcttggaaaacccgaagtactatagctac
attgccgtgctggcgctcatggcgaccaccatgttggtgcaggtcagccacatggtcaaa
gtcacgctcatgctcctaatcaccattgcgacgggtattgtcaacatttacagctggagg
gacatctttgaccgctacgatattgcccgcttccaggactacaggtcttacctggttccc
tccaaatatgccatgactctaatgatcttcataatgatgatcagcttctactatttttcc
cgacacgttgagaagctagcacgtactttgttcctttggaagattgaagtccatgaccag
aaggagaaggtgtatgagatgaggcgctggaatgaggcactggtcaccaacatgctgcca
gagcatgtagcacggcatttcctgggctccaagaaaagagatgaggaattgtacagccag
tcgtatgatgaaatcggtgtgatgtttgcctccatccccaacttctctgacttctacaca
gaggagagcattaacaatggggggatcgagtgcctcaggttcctcaatgaaatcatctca
gattttgacagcctcctggatgagtctcagttccgctgcatcaccaagattaagaccatc
ggcagcacctacatggcagcgtcaggggtaacccctgatgtcagcaatggctacgcttgc
ctgaagaaagaggagctttctgaccgagagcgctggcagcatttggcagatctggctgac
tttgctctggcaatgaaggtcacgctcatgaacattaactaccagtccttcaacaacttt
atgctacgcataggtttgaataaaggaggtgtgctggcaggggtgattggtgcccggaag
cctcactatgacatctggggaaacactgtgaatgtagcaagtcgcatggagtctactggg
gtcatgggtaatatccaggtggtggaggattgctacaacatcttgaaggagtacggcttc
cgttttgtgaggaggggacccatctttgtgaaggggaaaggagagcttctcacctacttt
ctgaaaggtcgagaaaaacagggttccttcatcaacggttcttcggtcaccctgccacac
caagtggtggacagctcctga

DBGET integrated database retrieval system