KEGG   Esox lucius (northern pike): 105006078
Entry
105006078         CDS       T04894                                 

Gene name
braf
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04150  mTOR signaling pathway
els04270  Vascular smooth muscle contraction
els04510  Focal adhesion
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105006078 (braf)
   04012 ErbB signaling pathway
    105006078 (braf)
   04068 FoxO signaling pathway
    105006078 (braf)
   04150 mTOR signaling pathway
    105006078 (braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105006078 (braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105006078 (braf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105006078 (braf)
   04914 Progesterone-mediated oocyte maturation
    105006078 (braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105006078 (braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105006078 (braf)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105006078 (braf)
Protein kinases [BR:els01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   105006078 (braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 105006078
NCBI-ProteinID: XP_012986864
UniProt: A0A3P8Y4P5
LinkDB
AA seq 773 aa
MAALSSAESPPPVFNGDTMDRDPERERGLGELGACLEPACSVGIPECPQDEEIWNIKQMI
KLTQEHLEALLDKFGGECNPPSIYLEAYEEYTSKLDALQQREQQLLEAMGNGTDLYSSSL
PDRGMGCSGVGQPLLPSAPNTLAVHQNPADGRVNPRSPQKPIVRVFLPNKQRTVVPARCG
MTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPLGWDTDISWLTGEELHVEVLENVPLTT
HNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLLVSKF
FEHHPITQEEVSSEGTTPMSEACPSLPPSDSTGSLCHATVSPSKSIPIPQTFRPGEEDHR
NQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLPRSEGGSTAGLSATPPASLPGSLTNV
KAPQKSPCPQRERKSSSSSEDRNKMKTLGRRDSSDDWEIPEGQITLGQRIGSGSFGTVFK
GKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYTTKPQLAIVTQWCE
GSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIG
DFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRLQDKNPYSFQSDVYAFGIVLYELMSGA
LPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMRRLMADCMKKKREERPLFPQILAS
IELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQGGYGEFSAFK
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggcggcgttgagcagcgccgagtccccaccgcccgtcttcaacggcgacacgatggac
agagacccggagcgggagaggggactgggggagctaggagcctgcctggagccggcatgt
tcggtggggatcccggaatgtccacaggacgaggagatctggaatatcaaacagatgatc
aagctgacgcaggaacacttggaggctctgctggacaagtttggaggagaatgcaatccc
ccatccatatatctggaggcctatgaagaatacaccagtaagttggatgccctgcaacag
agggaacagcagctcctggaggccatgggcaatgggacagacctctactcctcctctctc
ccggaccggggcatgggatgttctggggtcggccagcctctcctcccctctgcccctaac
accctggcggtccaccagaaccctgcagatggacgggtgaacccccgctcaccccagaaa
ccaatcgtcagggtcttcctgcctaacaaacagaggactgtggtacctgcccgatgcggg
atgacagtcagagactctctgaagaaggctttgatgatgagaggactgatacctgagtgc
tgtgctgtctacaggatacaggacggagagaagaagcctcttggctgggacacagacatc
tcctggctgacgggggaggagctacacgtggaagtcctggagaacgttccgctgacgacg
cacaactttgtgaggaagaccttctttacgctggcgttctgtgatttctgccggaaactg
ctgttccaggggttccgttgtcagacgtgtggttataagttccaccagcgctgtagcact
gaggttccacttatgtgtgtgaactatgaccagctagacctgttgttggtgtctaagttc
tttgagcaccaccccatcacccaggaggaggtgtcatcagagggcaccaccccgatgtct
gaggcctgcccttctctgcctccgtccgactctactgggtctctgtgccatgccactgtg
tccccgtccaagtccatccccatcccccagacgttccggcccggagaggaggaccacagg
aaccagtttggccagagagaccgctcctcttccgctcccaatgtccatatcaacaccatt
gaacctgtaaacattgacgacttgataagagaccaaggtttaccgagatcagaaggaggg
tcgactgcggggctttcggccacgcccccggcctcgctgcctggctcattgaccaatgtg
aaggctcctcagaagtccccgtgtccacagagggagaggaagtcctcatcctcgtctgag
gaccgcaataaaatgaaaaccctgggcagacgggactctagtgacgactgggagatccct
gaaggccagatcacactgggtcagagaatagggtcagggtcctttggaacggtcttcaag
ggcaagtggcacggtgatgtggcggtgaagatgttgaatgttacagctccgactcctcag
caactacaggccttcaagaatgaagtgggggtccttaggaaaacgcgtcatgtgaacatc
cttctgttcatgggatacaccaccaagcctcagctagccattgtgactcagtggtgtgaa
ggctctagtctctaccaccaccttcacatcatagagaccaagtttgagatgatcaaactc
atagatattgcccggcagaccgcccagggcatggattatctgcacgccaaatccatcatc
catagagacctgaagagcaacaacatatttctacacgaggacctgaccgtgaagataggc
gacttcggcctggccacggtgaagtctcgatggagcggctcgcaccagtttgaacagctc
tctggctccatcctgtggatggctccggaggtcatccgtctacaggataagaacccctac
agcttccagtcagatgtctatgcctttgggatagtcctctacgagttgatgtcaggggcc
ctcccgtactccaacatcaacaacagagaccagatcattttcatggtgggccggggctac
ctgtcccctgacctcagtaaggtgcgctccaactgtcccaaagccatgaggaggctgatg
gccgactgtatgaagaagaagagggaggagagacccttgttccctcagatcctggcatcc
attgagctgctggcgcgttctctacccaagatccaccgctccgcgtcggaaccgtctctg
aaccgggctggattccagacagaggatttcagcctgtatgcctgcgcctcccccaaaact
ccgatacagggaggatatggagagttttcagcatttaaataa

DBGET integrated database retrieval system