KEGG   Esox lucius (northern pike): 105006284
Entry
105006284         CDS       T04894                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X2
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04115  p53 signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04218  Cellular senescence
els04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105006284 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105006284 (pten)
   04070 Phosphatidylinositol signaling system
    105006284 (pten)
   04150 mTOR signaling pathway
    105006284 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105006284 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    105006284 (pten)
   04218 Cellular senescence
    105006284 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105006284 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105006284 (pten)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105006284 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     105006284 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105006284 (pten)
Protein phosphatases and associated proteins [BR:els01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105006284 (pten)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 105006284
NCBI-ProteinID: XP_019902319
LinkDB
AA seq 426 aa
MAAIIKEFVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDEVVRFLDSK
HKNHYKIYNLCIERHYDTTKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNQLEYKPVALLFHKMVFETVPMFSGGTCRDTSVKNKSEQIPHGFRKGNWHWDPQFVV
YQLKVKIHTSNPSNTRREEKYVFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPEEHFEKVENGTLPKEPEGIQTAAGTGDNDRDYLILSLTKNDLDKANKDKANRYF
SPNFKVKLYFTKTVEDPSNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEQH
TQITKV
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggctgcaatcataaaggaatttgtcagccgaaacaaaaggagataccaggaagatggg
tttgacttggacttaacttatatttatcctaacataattgctatgggctttcctgctgaa
aggctggagggtgtctacagaaacaacattgatgaggtagtacggtttctggactctaaa
cacaaaaatcactataagatttataatctgtgcattgagcgacattatgacacaaccaaa
ttcaactgccgagttgcacagtatccgtttgaggatcacaatcccccccagttggagctg
atcaaaccgttctgcgaagatctcgatcagtggcttagtgaggacgacaatcatgtggcg
gcgattcactgtaaagctggaaagggacgcacgggtgtcatgatctgtgcttacctacta
caccggggcaagttcctcaaagcacaagaagctcttgacttctacggcgaagttaggacc
agagacaagaagggagtaacgatccccagtcagaggcggtatgtctactactacagccac
cttttaaagaatcagttggagtacaaaccagtggcgttgctgttccacaagatggtgttc
gagacggtgcccatgttcagtggcggaacgtgtagggacacttccgttaaaaacaagagt
gagcagattccacatggtttcagaaaagggaattggcactgggatcctcagtttgttgtg
taccagctcaaggtaaagatccacacttccaaccccagcaacacgaggcgagaggagaag
tatgtgttcttcgagttccctcagccattgcctgtgtgtggtgacatcaaggtggagttc
ttccacaaacagaacaaaatgatgaagaaggacaagatgtttcatttctgggtgaacacc
ttcttcatccctggaccagaggagcattttgagaaggttgagaacggcacgttacccaag
gagccggaaggaatccaaacggcagcaggaacgggagacaacgacagggactacctgatc
ctctcactgaccaagaatgacctggacaaggccaacaaggataaagccaaccgatatttc
tcccccaatttcaaggtgaagctgtattttacaaagactgtggaagacccctccaactct
gaggccagcacctccacctcagtaacgccagacgttagtgacaacgagccggaccactac
cgatattctgacaccacggactcagaccccgagaacgaaccgtttgacgaggagcaacac
acacaaattaccaaagtgtga

KEGG   Esox lucius (northern pike): 105010650
Entry
105010650         CDS       T04894                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04068  FoxO signaling pathway
els04070  Phosphatidylinositol signaling system
els04115  p53 signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04218  Cellular senescence
els04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105010650
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105010650
   04070 Phosphatidylinositol signaling system
    105010650
   04150 mTOR signaling pathway
    105010650
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105010650
  09143 Cell growth and death
   04115 p53 signaling pathway
    105010650
   04218 Cellular senescence
    105010650
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105010650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105010650
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105010650
    3.1.3.48  protein-tyrosine-phosphatase
     105010650
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105010650
Protein phosphatases and associated proteins [BR:els01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105010650
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 105010650
NCBI-ProteinID: XP_010868419
UniProt: A0A3P8ZPL6
LinkDB
AA seq 438 aa
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKDHYKIYNLCAERHYDAAKFNCRVAQFPFEDHNPPQLELIKPFCEDLDQWLSKDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKNKLDYKPVALLFHKMVFETLPMFSGGTCRDSTVKNRSEPVPQGFKKGNWHWDPQFVV
YQLKVKIHTSNPAHTRREEKHMLFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNT
FFIPGPPEESLEKVENGSVVVNDVDGVQNQPQGAPQLPQSAEHRDSDRDYLILALTKNDL
DKANKDKANRYFSPNFKVMLYFTKTVEDSSNSEASTSTSVTPDVSDNEPDHYRYSDTTDS
DPENEPFDEEQHTQITKV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggctgcgataataaaagaaatggtcagccggaacaaaaggagataccaagaagatggt
ttcgacttggacttaacgtatatatatcccaacattattgctatgggatttcctgcagaa
cgactcgaaggggtgtacagaaacaatatagacgatgttgtacggtttcttgattcaaaa
cataaagaccattataaaatttacaatctttgtgcagaacgacactatgatgctgccaaa
ttcaactgcagagttgcacaattcccctttgaagaccacaacccgcctcagctagagctc
attaagccgttttgtgaagacctggaccagtggttgagtaaagatgacaatcatgtagca
gctatccactgcaaggcagggaagggacgcactggagtgatgatatgcgcctacctcctg
caccgcggcaagttccaggaagcccaggaggccctcgacttctacggcgaagtgcggacg
agggacaagaagggtgttacaatcccaagccaacggcgctatgtatactactacagccac
ctgctcaagaacaagttggactacaagccggttgctctcctctttcacaaaatggtgttt
gagacgctaccaatgttcagcggaggcacctgcagggacagtaccgttaaaaacaggagc
gagccagtccctcagggcttcaagaaagggaattggcattgggatcctcagtttgtggtg
tatcaacttaaagtcaagatccacacgtccaacccggcacacacacggagggaagaaaag
cacatgctatttgagtttccccagccgctgcccgtgtgtggggacatcaaagtggagttt
tttcacaagcaaaacaaaatgatgaagaaggataagatgttccacttttgggttaacacc
ttttttatccctgggccaccggaggagagcctggagaaggtggagaacggatccgtggtg
gtgaacgacgtggacggcgtccagaaccagccccagggcgcccctcagctcccacagagc
gccgagcacagggacagcgacagggactacctcattctcgcactcaccaagaatgacctg
gacaaggccaacaaagataaagctaaccgctacttctcgcctaatttcaaggttatgctg
tatttcacaaaaaccgtcgaagattcttcaaattctgaggcaagcacttcaacgtcagtc
actccggatgttagcgacaatgagcctgaccattatcggtattctgacaccactgactct
gatccggaaaatgaaccttttgatgaggagcagcacacgcagatcacaaaagtttga

DBGET integrated database retrieval system