KEGG   Esox lucius (northern pike): 105006515
Entry
105006515         CDS       T04894                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04114  Oocyte meiosis
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04350  TGF-beta signaling pathway
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04520  Adherens junction
els04540  Gap junction
els04620  Toll-like receptor signaling pathway
els04621  NOD-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
els05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105006515 (mapk1)
   04012 ErbB signaling pathway
    105006515 (mapk1)
   04350 TGF-beta signaling pathway
    105006515 (mapk1)
   04370 VEGF signaling pathway
    105006515 (mapk1)
   04371 Apelin signaling pathway
    105006515 (mapk1)
   04068 FoxO signaling pathway
    105006515 (mapk1)
   04150 mTOR signaling pathway
    105006515 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105006515 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105006515 (mapk1)
   04210 Apoptosis
    105006515 (mapk1)
   04218 Cellular senescence
    105006515 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105006515 (mapk1)
   04520 Adherens junction
    105006515 (mapk1)
   04540 Gap junction
    105006515 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105006515 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105006515 (mapk1)
   04621 NOD-like receptor signaling pathway
    105006515 (mapk1)
   04625 C-type lectin receptor signaling pathway
    105006515 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105006515 (mapk1)
   04912 GnRH signaling pathway
    105006515 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    105006515 (mapk1)
   04916 Melanogenesis
    105006515 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105006515 (mapk1)
   04270 Vascular smooth muscle contraction
    105006515 (mapk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105006515 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105006515 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105006515 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105006515 (mapk1)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105006515 (mapk1)
Protein kinases [BR:els01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105006515 (mapk1)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105006515 (mapk1)
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105006515 (mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kinase-like Kdo
Other DBs
NCBI-GeneID: 105006515
NCBI-ProteinID: XP_028980438
LinkDB
AA seq 369 aa
MATAAVSACAGSGPNPGSGAELVRGQAFDVGPRYHNLSYIGEGAYGMVCSAYCRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRMPSIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFNTVCRS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtatctgcctgtgctggcagcggccccaaccccggatcgggcgca
gagttggtccgtggacaggccttcgatgtcgggcctcgctaccacaatctctcctatatc
ggcgagggcgcctatggaatggtgtgctctgcgtattgccgtgacaacaaggttcgcgtg
gcgataaaaaagatcagtccctttgagcaccagacctactgccagcggacgctccgagag
attaagattctgctgcgcttcaaacacgagaacatcattggcatcaacgacatcatccgt
atgccatccattgaccagatgaaggatgtgtacattgtgcaggacctcatggagacagac
ctgtacaagctgctgaagacccaacacctgagcaacgaccacatctgttacttcctgtac
cagatcttgagaggcctcaagtacatccactctgccaatgtcctgcaccgagacctcaag
ccctccaacctactgctcaataccacctgtgacctcaagatctgtgactttggtctggca
cgtgtagcagacccggaccacgaccacacaggtttcctgacagaatatgtagccactcgt
tggtaccgagcgcctgagatcatgctcaactccaagggttacactaaatctattgacatc
tggtcagtgggctgtatcctggcagagatgctgtccaacagacccatcttccctgggaaa
cactacttggaccagctcaaccatatactgggtatcctaggttctccttcccaggaggat
ctgaactgcatcatcaacatcaaggccaggaattacctgttgtctctcccgctgcgctgt
aaagtgccctggaacaggctgttccccaacgccgaccctaaagcgttggacctgctagac
aaaatgttgacctttaacccccacaagagaattgaggtggaggaggctctggctcaccct
tatctggagcagtactacgaccccacggatgagcctgtagcagaagctccctttaaattt
gacatggagctggatgacctccccaaagagacactgaaggagctcatctttgaagagacg
gcacgtttcaacactgtctgcaggtcctaa

KEGG   Esox lucius (northern pike): 105012809
Entry
105012809         CDS       T04894                                 

Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04114  Oocyte meiosis
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04350  TGF-beta signaling pathway
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04520  Adherens junction
els04540  Gap junction
els04620  Toll-like receptor signaling pathway
els04621  NOD-like receptor signaling pathway
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
els05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105012809
   04012 ErbB signaling pathway
    105012809
   04350 TGF-beta signaling pathway
    105012809
   04370 VEGF signaling pathway
    105012809
   04371 Apelin signaling pathway
    105012809
   04068 FoxO signaling pathway
    105012809
   04150 mTOR signaling pathway
    105012809
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105012809
  09143 Cell growth and death
   04114 Oocyte meiosis
    105012809
   04210 Apoptosis
    105012809
   04218 Cellular senescence
    105012809
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105012809
   04520 Adherens junction
    105012809
   04540 Gap junction
    105012809
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105012809
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    105012809
   04621 NOD-like receptor signaling pathway
    105012809
   04625 C-type lectin receptor signaling pathway
    105012809
  09152 Endocrine system
   04910 Insulin signaling pathway
    105012809
   04912 GnRH signaling pathway
    105012809
   04914 Progesterone-mediated oocyte maturation
    105012809
   04916 Melanogenesis
    105012809
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105012809
   04270 Vascular smooth muscle contraction
    105012809
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105012809
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105012809
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:els03036]
    105012809
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105012809
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     105012809
Protein kinases [BR:els01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   105012809
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     105012809
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105012809
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 Choline_kinase YukC
Other DBs
NCBI-GeneID: 105012809
NCBI-ProteinID: XP_012991171
UniProt: A0A3P9AMH2
LinkDB
AA seq 392 aa
MADSSSSVAAVGATGSNTGAAGSGGALAPEGATGTAGTKPVLEVVKGQNFDVGPRYVNLS
YIGEGAYGMVCSAHDTMTDSRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDI
LRARRIECMRDVYIVQDLMETDLYKLLKTQMLSNDHTCYFLYQILRGLKYIHSANVLHRD
LKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSI
DIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPTPDDLNCIINMKARNYLQSLPE
KPKIPWNKLFPKADSKALDLLGRMLTFNPIKRITVEDALAHPYLEQYYDPTDEPVAEEPF
TFTMELDDLPKEKLKELIFEETARFQATYQGS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggattctagcagcagtgtcgcggcggttggagccacaggctcaaatactggtgcc
gccgggtctggtggtgctcttgcgcccgagggagcgactggaacggcggggaccaagccc
gtgttggaggtggtgaaggggcaaaactttgacgtaggccctcgctatgtcaacctgtct
tacatcggggaaggggcctatggaatggtttgctctgcccatgacaccatgacagactcg
cgtgtggccattaagaagatcagtccatttgagcaccagacgtactgccagcgcaccctg
agggagatcaagatcctgcttcggttccgccatgagaacatcatcggcatcaacgacatc
ctgagggcccggcgcatagagtgcatgagagatgtctatatagtgcaggacctgatggag
acagacctgtacaagctgctgaagacccagatgttgagcaacgaccacacttgctacttc
ctgtatcagatcctgagaggtctgaagtacatccactctgccaacgtgctgcaccgcgac
ctcaagccctccaacctgctcatcaacaccacctgtgacctcaagatctgtgactttggg
ctggcgcggatagccgacccagagcatgaccacacaggtttcctgacagagtacgtggcc
acccgctggtacagggctccagagatcatgctcaactctaagggctactccaagtccatt
gatatctggtcagtgggctgtattctggctgagatgctgtccaacagaccaatcttccct
gggaagcactatctggaccagctcaaccatatcttgggcatcctgggctctcccactccg
gacgacttgaactgcattatcaacatgaaggccaggaactacctgcagtctcttcctgag
aagcccaagattccctggaacaagcttttccccaaggccgacagcaaggctttggacctg
ctgggacgtatgttgacctttaatcctattaagcgcatcacggtggaggatgccttggcc
cacccgtacctggaacagtactacgaccccacagatgagcccgtagcggaggaaccgttc
actttcaccatggagctggatgatctgcctaaggagaagctgaaggagctcatctttgag
gagacggcccgctttcaggccacttaccaaggctcctga

DBGET integrated database retrieval system