KEGG   Esox lucius (northern pike): 105006742Help
Entry
105006742         CDS       T04894                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
  KO
K04543  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
Organism
els  Esox lucius (northern pike)
Pathway
els04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105006742
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105006742
   04031 GTP-binding proteins [BR:els04031]
    105006742
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105006742
  Exosomal proteins of other body fluids (saliva and urine)
   105006742
GTP-binding proteins [BR:els04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    105006742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma FtsX_ECD
Motif
Other DBs
NCBI-GeneID: 105006742
NCBI-ProteinID: XP_010863704
LinkDB All DBs
AA seq 68 aa AA seqDB search
MSTNNNIAQARKLVEQLRIEAGIERIKVSKAAADLMSYCEQHARNDPLLVGMPTSENPFK
DKKPCVIL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccaataacaacattgctcaagccaggaaactggtagaacagctgaggattgag
gcagggatcgaacgtattaaggtgtcaaaagccgctgcggacctgatgagttactgtgag
cagcatgcccgtaatgacccactcctcgttggcatgccaacgtcagaaaaccctttcaaa
gacaagaaaccctgcgtaatcctatag

DBGET integrated database retrieval system