KEGG   Esox lucius (northern pike): 105006884
Entry
105006884         CDS       T04894                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105006884
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    105006884
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 SGL EGF_CA He_PIG
Other DBs
NCBI-GeneID: 105006884
NCBI-ProteinID: XP_028975921
LinkDB
AA seq 4580 aa
MSLLGLYPLSLLLLSQRIQLVQGQCISGQFQCANGQCIDSDWRCDGIQDCTDDTDELNCS
PPSCSSQQFKCLTGSECIPLQFVCDGEEDCNDGSDEQRACGTQTCGPHQFTCLEGQCIPK
AYQCDHLMDCLDNSDEKNCNYPTCNEKTCANGACYNTSQHCNGLPDCRDGSDESNCTTQH
CSLHQFQCTNGYCIPTSFVCDHWNDCGDNSDEHSCVYPSCSGTQFTCPSGLCIPQDWVCD
KFNDCGDYSDEKGCDSNSRDCYPGEWACPDSPMCVPVDKVCDGKPDCPGGTDETDAATKQ
TCSLDRCSALSCVYMCHLTPQGGACFCPDGFIVANDSRSCVDYDDCDIWGICDQLCEDRP
GTHHCSCADGYFLEQGNHCRANISAGLPQLIFTNGGDVMMADIQGRFVRTLVPSQGRGRS
VGVGYHWNSQTVFWTDTNSQKVYSANFDGGDIKDVLTQAVRSAENIAVDWINLKLYVLET
TVERIDMCDFDGDNRVTLVAENLLTPHGLALDPTVGYMFFTDLGYVREDMKLERAYMDGS
NRVELVKTRLGMPTGITLDIVTQRVYWSDSHFDMVETVTYNGLERKTVLNGGTQVPYPFG
ISVFENHVFFTDWNKMGVIRTNRFNGSDPTLIYRTANTPGHIVVAHPVLQPMVMSPCGRH
NGGCQHICVLSHRTDNDGLGFRCKCRLGYDLHEDGRSCFKVRNYLLLATEYAVRGIPLNV
SLQEDVTLPLTGLAPTFSCSAVEFDGNEEVVFYNDRSRQIVYKSNINGSNTQILTGYRVG
HAEAMAYDWTSKVLFWTSSNYRVVVAFGVNDKSRRDIVTDLKNPRGLAIHPSEGYLFWSD
WYRPAVIMRSWTDGSNAVPLINTTLGWPNGLAIDYKNNRLYWVDALLDQIGHVDINGYDR
QMFSYIGQITQPFSLTIQAEYLFVSDTRTRSVFRMQKRDGGEIIPIRKGISGILNVKAYT
ADLHGMYNSQCNMVPNGHCSHFCFPAPSSSRVCGCPYGMKLQPNQRDCVKDDSVPPVDTN
CGEYSFLCDVDRCHPNSFWCDGIKDCLDQTDEANCTDIGMTCSPHAFTCDNKHCIMPGWR
CDGHDDCGDYSDEVNCPTRLPFTCSPEQFPCADGSRCIPKAWTCDADKDCSDGSDERDCN
GTISTCQPGYFFCPDHRCIYSSYVCDGDQDCMDGSDEKDCEFSCSSSEFACVAGDQCVQS
AYRCDGVYDCRDHSDESGCPTRGPGLCHDNEFQCQMDGLCLPGEWECDGHRDCEDGSDEH
NSCPTITCQTNYFQCANGNCISPSWVCDGDNDCRDMSDEQNCPTPPFTCASGQWLCPTDQ
VCIALGKVCDGQRDCPNGADESPLCNEEDCSLNNGGCSDGCIQGPFGSECTCPPGYQLLN
DSKTCDDIDECSIPGWCSQQCYNERGSFRCSCSDGYLLEPDGRTCKAADSAAATLLVTKR
SQIISSKVNLRPPLIHPVVSGSDIVTVDFDHLTDRIYWADTSLKKIYTSFLNGTDIREVF
STGLVVPESIAVDWVGRNLYWTDSVMENIEVSTLDGHFRKVLLTKNVTRPRGLALDPRTQ
TNLMFWSDWGQNPRIERAFMDGSGRQAIVTTKLYWPNGLALDYSTRRVYFADAYLKYIDY
CDYNGNNRFQVMASDAVLQHPHSMTIFEDQIYWSERYTSQILRTNKFHGGNTTTVMTSVN
QPMGIVMDHPIKQPAVVNPCAEHLCGQLCLLSGLRPRFYNCHCQAGWKLSTDGHTCTKDD
SPFLMVVKETVILGIPLDPANPSNNAMLPVSGITQGKDIDFDDQEQFVYWVQGSNSIYRV
KTDGTNRTQFAPSSILGSPSGLAFDWITRMMYYTNPTNKAIEVIRVDGDQHYRKTLITDT
GKPEGAGEPIGLALDPANGKLFWTDRGTNGGVPPKVASADMDGGNLRNLYTTNLDNIGFI
TIDITTRKLYWGVVSTGVIECGTVDGVSRTTIVSQLSQPWGLTVHQNYLYYSDLDYEVIE
RVDKDTGGNMVLLRSGMTGVRAVKVHARDDSAGTTNGCSTSNGGCPHLCLPKPGGQKTCA
CTTGFVLSQDGTTCMQYDSYAVVSTPKLIRGFHINSSDHSEAMVPVAGNYYSEIGNLDLH
IASGYIYWMDNSTWSAYRGIFRAQTNGGGFSHVINQGIGLGGVHGIAVDWIAGNLYFTNA
FGSQTYLEVTRLETPYRTILLKCTEDRPSDLAVSPKLRFLFWADGGQNPKIERAQLDGSN
RTVLASESLASPRGLTVDYTNDVLYWADEGLDMISRMAPDGTQRQIVRYGSRYPAPYGLS
IFGNSMLWVDRKLGKLFQASKDPANTTQPEVIRNGVDGLTDVVVFDSHVQPTAANLVGFN
PCQEDNGRCQQLCFALPEQEKPTCACAHGSLLSNGVTCGYGLDEFLVFTTDNSLDSLRLD
PADHSVPYPTVSLDFSVVALDFDFADKRIFFTQYMGTGRSRIGYVITTVSAAPVILANNL
NDPEGLAYDWIHKRLYFTDYYDKSVQAIGVDGQNRSLIAHANRPRGIIVDPCYGYLYWTD
WGSPAKIERSTLGGNFRVPVINTGLSQPNGLSIDYQERMLYWTDSSLDKIERSSLTGENR
QVILSGLQYPYSMTVFQQDIYWTDWTARSVYRAGKDDGSGFTVLAQELQYKPNDVHVYAS
SKQEACSSPCQQYNGGCSHVCVPGPSGPECQCPSTGSWYLANNGKDCIHDSGDRCKPDQF
TCLNGGCISARWKCDGYSDCQDGSDELERVCAFHVCSAQDFTCDNGRCVPVSYACDYTDD
CGDNSDELGCPFPTCAPDTEFTCTNGRCISAAFVCNGFNDCRDNGTSDEINCPPRTCPSG
QTKCDSTNICIYPDQLCDGFNNCGDNSDENALFCEGRTCSPDQFQCDQGKCIPSHWVCDW
IKDCADGTDEPPSCQEQINTCHPDQFTCTNGNCIPSSLTCDGNNDCWDNSDEKPELQCGE
RTCASHQFTCPPPWRPGHPRCIPLSFVCDGDKDCADAADELQNCPNRTCHMNEFTCANGL
CIHVPFHCDRVNDCGDGSDELGCSYDPCDSHQFTCQNGACIPGSFACDGAADCLDGSDEA
ESVCSTPQATCAPTEYLCKSGECIDNHKVCNSQNDCTDSSDEKGCGINECSDPSVHKCAQ
LCTDTQTGYYCSCLAGYSLMPDGKACADIDECSDTPAVCSQICDNSAGSFHCKCAPGYLR
EPDQRGCRQNSGIAPYLLYSNRYYIRNLTTDGTQLSVVLQGLTDAVALDFDHYEKRLYWL
DAGLGQIERMRFDGSERETIVNDNLVGAEGLALDWVGRKLYWVESYYGALHVSELDGRFQ
KKLLSGCMGPNSTYCFVQPRAVALNPKYGWMYWTDWGSTAYIGRVGMDGTNATALITTKL
EWPSALTIDYTTNKIFFADSHLNFLDFADMDGSNRHRAIAGSLPHPYAVTLFEDWVYWTD
RNTHTVEKAHKYTGASRVVMGNNTHRPTDIHVYHPYRQPSSNNPCTTHHTTCSHLCLIGP
GGTSASCECPDHFIGLSVGFQFQCVADCSSTQFRCGDNEKCISIWWKCDGQSDCGDGSDE
PLTCPPRYCSIGQFQCQDGNCTHPAYLCDKHSDCPDGSDEDAALCSDHRCAENEFQCKNK
QCIPVSWHCDGFSDCTDGTDEDMEACAQKTCRPGQFTCANGHCIQPQYVCDVDNDCGDWS
DEPHWICVGPEHKCDELTEFSCISDYRCIPAWAVCDGTNDCIDSSDERNCEALTCDPLGD
FRCDNHLCVPIRWKCDGSNDCGDGSDERNCVPRPCSESEYRCDNQQCIPGKWVCDHDNNC
GDNSDERDCELQTCLPGYFQCLSGHCIPAALKCDGRPDCLDISDESSCPTRYPGGRWCPN
NQFQCANKLCVQQNYVCDGENDCGDRSDEELRLCFNISCEMPSRFRCANGYCIYSGNLCN
QKDDCGDGSDEMPDVCRDPTLAPCTPQEFKCVNGQCVAQPDVCDHIDNCGDLTDEIGCNV
GHNRNCEEKLCQHVCTNLNGTGFICSCRPGYKVDPDSTFKCIDINECEGHGTCPQICKNT
KGGYECVCAPGYRKVGNGNECEAEGAGPLLLLPENIRIQKFNLQTETFHDFLVEQEHIIA
LDYDWDHNNTGLSMVYFTVAAKDDAAAGIKRAYIPTVDDNSNNIATAVDLGIKYVTSPDG
IAVDWVGRNLYWADSTIKRIEVAMLDGRYRKHLVKTDIGHPSALAVNPRLGMLYWADRGT
AAKIEYSWLDGQHRNVLVPDGLGWPTGLSIDYANGDRVYWSDAKESRIESVLPSGEDRRT
ALYIDVRKPFSINVFENHIYWSTQEKGEVFRQDKFGRGTKIKLLTAGPWLTQISVYQQQR
YNSIRMKSPCKGICSHLCLLRPGGYTCACPEGTNFVSGSQTECDAGFEPPPTMPPLCQCT
NGGTCYFDDSKALCICPPEFEGEFCEINAFGVVASSVGIAIGVTVAIVILLGGLVYTAQR
KSSIMETMRHIMPSMPSMPSFRGFPSQSSGPSKEEGSELDLSLKVENLENPLYAEPDVVH
VVAGPEPKTGATPAYMVSVKEGTFGNAECSSDSGEVVTPKEPVADTSLKFKLIPDSVDNS
FINPLFSDLTLPSTPTDSFV
NT seq 13743 nt   +upstreamnt  +downstreamnt
atgagcctattaggtctatatcccctgtcccttttattgctttctcaaaggattcaactt
gttcaaggccaatgtatcagtggccaatttcagtgtgccaatggccagtgcattgactcc
gactggaggtgtgatggaatccaggactgcacagatgacactgatgagcttaactgttcg
cctccatcttgtagctcccagcagtttaagtgtctgacagggagtgagtgtatccccctc
cagtttgtctgtgatggggaggaggattgcaatgacggctctgatgaacagagagcctgt
ggaacacagacttgtggaccacaccagttcacatgcctcgagggccagtgtatacccaaa
gcttaccagtgtgaccatttgatggattgcttggacaactcagatgagaaaaactgcaac
taccctacctgcaatgagaaaacatgtgctaatggggcttgttacaacacctcacagcac
tgcaatgggctgccggactgtcgggacggctcagatgaatccaactgcacaacacagcac
tgttccctgcaccaattccagtgcactaatggctactgtatcccaacgtcctttgtctgt
gaccactggaatgactgtggggacaacagtgatgagcacagctgtgtgtatcccagctgc
agtggaacacagttcacctgtcccagtggcctctgcatccctcaggactgggtctgtgat
aagttcaacgattgcggggactatagcgatgagaaaggatgcgatagtaactcccgagac
tgttaccctggcgagtgggcatgtccagactcccccatgtgtgtgccggttgacaaggtg
tgcgacggcaaacctgactgccccggcggaaccgatgagaccgacgctgccacaaagcaa
acctgcagcctggacaggtgttcagcactgagctgtgtgtacatgtgtcacctgacccca
cagggcggggcctgcttctgcccagatggcttcatcgtggccaatgacagccgctcctgc
gtggattatgatgactgtgacatatgggggatctgtgaccagctgtgcgaggaccgccca
gggacccatcactgcagctgtgcagatggatacttcctggaacagggcaaccactgcagg
gccaacatctcagctgggctgcctcagctcatttttaccaatggtggcgatgtgatgatg
gcggacattcaggggcgcttcgtcagaactttggtcccttctcagggcagaggtcgctct
gtgggagtggggtaccattggaacagtcagacggtcttctggacagacactaactcccag
aaggtgtactctgctaactttgacggaggcgacatcaaggatgtgctgactcaggccgtc
cgcagtgccgagaacatcgctgtagactggatcaacttaaagctctatgtgctggagacc
acggtggagcgcatagacatgtgtgactttgatggagataaccgggtcactcttgtggcc
gagaacctgttgactccccatggactggctctggaccccactgttgggtatatgttcttc
actgacctgggctacgtccgtgaggacatgaaactggagagggcctatatggacgggagt
aaccgcgtggagcttgtgaagacccggctggggatgccgactggcatcaccttggatatc
gtcacgcagagggtctactggtcagacagccacttcgacatggtggagacagtcacctac
aatggtctagagaggaaaacggtgcttaacggcggcacccaggttccgtacccatttggc
atttccgtctttgagaaccacgtcttcttcaccgactggaataagatgggagttatacga
accaaccgcttcaatggaagcgacccaacccttatataccgcaccgcaaatacacccggt
cacattgtggttgcacacccagtcctgcagcctatggtgatgagtccgtgtggtcggcac
aatgggggatgtcaacacatctgcgtcttgagccaccgcactgacaatgacggcctgggc
ttccgctgcaagtgtcgcctgggttacgaccttcacgaagacggccgcagctgcttcaag
gtgagaaactacctcttgctcgccactgaatacgcggtgcgagggatccccctgaatgtg
tccctccaggaggatgtaaccctgccactgaccggtctggctcccaccttctcctgctcg
gctgtggagtttgacggcaacgaagaggtggtgttctacaacgaccggagcaggcagatc
gtatacaagtccaacatcaacggctccaacacacaaatactgaccggctacagggtaggt
catgcggaggccatggcgtacgactggacgtccaaggtcctcttctggacttccagcaac
tatcgggtggtggtggcctttggtgtgaacgacaagtcaagacgtgacattgtgacagat
ctgaagaacccaagaggtcttgctatacaccccagtgaaggatacctgttctggtctgac
tggtaccggcctgcagtgattatgcggtcctggactgatggcagcaacgctgttcccctc
attaacaccactctgggctggcctaatggacttgcaattgactacaagaacaacaggctg
tattgggtggacgcccttctagaccagataggccacgtagacatcaacggttatgacaga
cagatgttctcctacatcggacagatcacacagcccttctccctcaccatccaagcagag
tacctgtttgtgtcagacacaaggaccaggtcagtgttccggatgcagaagagggatgga
ggggaaattatcccaatccgaaagggaatctctggaatcctaaatgtcaaggcttacaca
gctgaccttcatggcatgtacaacagccagtgcaacatggtccccaacggccactgcagc
cacttctgcttccccgcaccctcgtccagccgcgtgtgtggttgcccgtacggcatgaag
ctccagcccaaccagagggattgtgtgaaggacgactcggtcccccccgtagacaccaat
tgcggggaatactctttcctctgtgacgtggaccgctgtcatccaaactccttctggtgc
gacggcattaaagactgcctggatcagacggatgaggccaactgcaccgatataggcatg
acatgctccccacatgccttcacctgcgacaacaaacactgcatcatgcctggctggcgt
tgcgacggccatgacgactgtggtgactactcagacgaagtcaactgcccaacgcgtctg
ccgttcacctgcagtccggagcagttcccctgcgccgacggcagcagatgcatcccaaaa
gcctggacgtgtgacgccgacaaggactgtagcgatggctcagacgaaagggactgcaat
gggaccattagcacgtgtcagcctgggtacttcttctgtcctgaccaccgctgcatctat
agctcctatgtgtgtgatggagaccaggactgtatggacggctctgatgagaaggattgc
gagttctcctgttcctccagtgagtttgcctgtgtcgcgggtgaccagtgtgttcaaagc
gcctaccgttgtgacggagtctacgactgcagggaccactccgatgagagcggctgtccc
acgcgaggacctggcctctgccacgacaatgagttccagtgccagatggacggcctgtgc
ctgcccggcgagtgggagtgcgatgggcacagagactgcgaggacggctcagatgaacac
aactcgtgccccactatcacctgccaaactaactacttccagtgcgccaacggcaactgt
atctccccgagctgggtgtgcgatggtgacaacgactgcagggacatgagcgacgagcag
aactgccccacccctccattcacttgcgcctcaggccagtggctgtgtcccactgaccag
gtgtgcattgccctggggaaggtgtgcgatggacagagggactgccccaacggagctgac
gagtcacccctctgcaatgaggaggactgttcgctgaacaacgggggctgtagcgacggc
tgtatccaaggtcctttcgggtccgagtgtacttgtccgccaggctaccagctcctaaac
gactccaagacctgtgatgacatcgacgagtgttccatcccgggttggtgtagtcagcag
tgctacaacgagagaggctccttccgatgctcctgctcagatggctacctactggagccc
gatggtcgtacctgcaaagccgcagattccgcagcggccacgctcctagttaccaagcgc
agtcagatcatctccagcaaagtcaacctccggccacccctcatccaccctgtggttagc
ggttcagatatagtgaccgtggactttgaccacttgacagacaggatctactgggccgac
acctctttaaagaagatctatacctcctttctgaatggcacagacatacgagaggtgttc
tccactggtctagtggtaccagagagcatagctgtggactgggtggggagaaacctttac
tggactgactcagtgatggagaacatcgaggtgtccaccctagatggtcactttaggaag
gttcttctcaccaagaatgtcaccagaccccgtggactggctctggacccccggacccag
accaacctaatgttttggtcggactggggtcagaacccgaggatagagagggccttcatg
gatggcagcgggaggcaggccatcgtaaccaccaaactctactggcccaatggtctggcc
ctagactacagcacacgacgtgtctactttgcggacgcctacctgaagtacattgactac
tgcgactacaacggcaacaaccgcttccaggtcatggccagtgatgcggttctccagcac
ccccacagcatgactatcttcgaggatcagatctactggtcggagcgctacacctcccag
atcctaaggaccaacaagttccacgggggcaacacaaccaccgttatgaccagtgtcaac
cagcccatgggcattgtcatggaccaccccatcaaacaacctgctgtggtcaacccttgt
gcagagcacctgtgtggtcagctgtgcctcctgtcgggcctgaggccccggttctacaac
tgccactgtcaggctgggtggaagctcagcactgatggacacacctgcacaaaagatgac
tctccattcctgatggtggtgaaagagacagtgattttgggcatccctctggatccggcc
aacccctccaacaatgccatgctgcctgtgtccggcattacacagggaaaggacatcgac
tttgacgaccaagagcagtttgtctattgggtacagggatcgaactccatatacagggtg
aaaacagatggaaccaataggactcagtttgctccatcttcaatccttggctcgccctcc
ggtttggcttttgattggataacacgcatgatgtactacactaatccaaccaacaaagct
atagaggtcattcgtgtggatggagaccagcactacagaaagactctgatcactgacaca
gggaagcctgagggagccggagagcctataggattagccctggacccagctaatggtaag
ttgttctggacagaccgggggaccaacgggggcgttcctccgaaagttgccagtgctgac
atggatggaggcaacctgaggaacctgtacaccaccaacctagataacatcggcttcatc
accatcgacatcaccacgagaaagttgtactggggcgtggttagcacaggagtgattgag
tgcggcacggtggacggggtcagcagaacgaccatagtgagccagctgtcccagccttgg
ggcctcacagtgcaccagaactatctctactacagcgacctggactacgaggtcatcgag
agggtggacaaggacactggcggcaacatggtgctgctgaggagtggcatgaccggggtc
cgtgccgtcaaagttcacgcccgagacgactcggctggcactaccaacggctgcagcacc
agcaacggcggctgtccccacctgtgtctgcccaagcctgggggacagaagacatgtgcc
tgcaccacaggcttcgtgctttcccaggatggcaccacctgtatgcagtacgactcctac
gccgtggtctccacccctaaactcatccgaggcttccatatcaacagctccgaccactca
gaggcaatggtgcctgttgccggaaactactactctgagataggcaacttggatcttcac
atcgcctctgggtatatctactggatggacaacagcacctggagtgcctaccgggggatc
ttcagggcccagaccaacggaggaggcttcagccacgtcatcaaccagggcatcggccta
gggggtgtacatggcatagccgtagactggattgcaggaaacctttacttcaccaacgcc
ttcggttcccagacctacttggaggtgacccgcctcgaaactccctaccgcaccatcctc
ctcaagtgtacagaggatcggcccagtgacctagccgtcagccccaaactgcgcttccta
ttctgggccgatggaggccagaatcccaaaatcgaacgtgcacagctagatggtagcaac
cgtactgtgttagcctccgagagcctggcatctccacgtggcctcaccgtggactacacc
aacgatgtcctgtactgggccgatgaagggctggatatgatatcgcgcatggcgcccgat
ggaacgcaaaggcagattgtccggtacgggagtcgatacccggcaccgtacggattgtca
atatttgggaattctatgttgtgggtggataggaagctcggaaagcttttccaggccagc
aaggatcctgcgaataccactcagccagaggtcatccgcaacggtgtcgacgggctcacg
gacgtggtggtcttcgactcccatgtgcagcccacggctgccaacctggtgggcttcaac
ccttgccaagaggacaacgggcgctgccagcagctctgctttgccttgcccgagcaggag
aaacccacgtgcgcctgcgcccacggctcgctcctcagcaatggcgtcacgtgcggctat
ggtctggatgaattcctagtgttcaccaccgacaactctctggacagtttacgtttagac
cctgcagatcactctgtcccctacccaactgtcagcctggacttcagtgtggtggcgctg
gatttcgactttgcagacaagaggatctttttcactcagtatatggggacaggtcgaagc
aggataggctatgtgatcaccacggtgtccgccgctcctgtcatcctcgccaacaattta
aatgatccagaggggctggcctatgactggatccacaagcgcctctacttcacagattac
tacgataagagtgtccaggccattggagtagatgggcagaaccgctctctcatagcccat
gccaaccgccctcgtggcatcattgtggacccctgctacggctacctttactggacagac
tggggcagccctgctaagatagagaggtctacactgggtgggaacttccgggtgccagtc
atcaacacgggtctgtcccagcccaatggcctctctatcgactaccaggagagaatgctc
tactggaccgactcgtccctagataagattgagcgctccagcctgaccggggagaaccgc
caggtgatcttgtccgggctccagtacccatactccatgaccgtcttccagcaggacata
tactggactgactggacagctcgctcggtctaccgtgccgggaaggatgacgggtcaggc
ttcactgtcctggcccaggaactgcagtacaagcccaatgacgtccacgtgtacgccagt
tccaaacaggaggcttgctcaagcccgtgtcagcagtacaacggcggctgtagtcatgtc
tgcgtgccaggcccgtctggtccggagtgtcagtgtccctcaacaggtagctggtacctg
gccaataacggcaaggactgtattcatgacagcggtgaccgttgcaagccggaccagttc
acctgcctgaacggtggctgcatctcggcgcgttggaagtgcgacggctacagcgactgc
caggacggctcagacgagctggagagagtctgtgccttccatgtgtgctcggcccaggac
ttcacctgtgacaacggccgctgtgtgcccgtgtcctacgcgtgcgactacaccgacgac
tgtggcgacaacagtgacgagctgggctgcccgttccccacctgcgcccccgacaccgag
ttcacctgcaccaacgggcgctgcatctcggccgccttcgtctgcaacggcttcaacgac
tgccgcgacaacggcacctcggacgagatcaactgcccgccaaggacatgtccatcggga
cagaccaagtgtgacagcaccaacatctgcatctaccctgaccaactgtgcgacggcttc
aacaactgtggagacaacagtgacgagaacgctctgttctgcgagggacggacgtgctcc
ccggaccagttccagtgtgaccaggggaagtgtatacccagccactgggtgtgtgactgg
atcaaagactgcgccgatggtactgacgagcccccctcctgccaggagcagataaacacc
tgtcaccctgaccagttcacctgtacaaacggcaactgtatcccctcgtcactgacctgt
gacggcaacaacgactgttgggacaacagcgacgagaaaccagagcttcaatgcggagag
cggacatgtgcttcccatcagttcacctgccctcctccatggcgcccaggccaccctcga
tgcatccccctgagctttgtgtgcgacggggataaggactgtgccgacgcagccgacgag
ctgcagaactgccccaaccgcacctgccacatgaacgagttcacctgcgccaacggcctg
tgtatccacgtccccttccactgtgacagggtcaacgactgtggagatggcagtgacgag
ctgggctgttcctatgacccctgcgacagccaccagttcacctgccaaaacggcgcctgc
atcccaggctcctttgcgtgcgacggggccgccgactgcttggatggttccgacgaggcg
gagagcgtgtgcagcactccccaggccacctgtgcgccgacggagtacctgtgcaaatca
ggagagtgtatcgacaaccacaaggtctgcaattcacagaacgattgcacggacagcagc
gacgagaagggatgcggaattaacgaatgcagcgacccgtctgtccacaaatgtgcccag
ttatgcaccgacacgcagacgggttactactgctcgtgcctcgccggatacagcctcatg
cccgacggcaaggcgtgcgccgacattgacgagtgtagcgacacgcccgctgtctgcagt
caaatctgcgacaactcggcgggttccttccactgcaaatgcgccccggggtacctgcgc
gagccagaccagcgcgggtgccgccagaacagcggcatcgccccttacctgctgtacagc
aatcgttattacatccgtaatctgaccacggacgggacgcagctgagcgtggttctgcag
gggctgacggacgcggtggcgctggatttcgatcattacgaaaagaggctttactggctg
gatgcgggactcggtcagatcgagaggatgcgattcgatggcagtgagagggagacgatt
gtgaatgacaacctggtaggggctgaggggctggccttggattgggttggcaggaaactg
tactgggtggagagttattacggcgctctccacgtgtctgagctggatggacgtttccag
aagaaactgctgagtggttgcatggggcctaattccacctactgttttgtccagccccgt
gctgtggcccttaaccccaaatacggctggatgtactggacagattggggctccacagcc
tacatcggcagggttggcatggatggcaccaacgccactgccctcatcaccaccaaactg
gaatggcccagtgccctgactattgactacaccaccaacaagatcttcttcgcagactcc
cacctcaactttctagattttgctgatatggatgggagtaaccgccaccgggccatagcg
ggctccctgccacacccttacgcagtcaccctgtttgaagattgggtctactggaccgac
cggaacactcacacagttgagaaggcccacaagtacacaggtgccagccgcgtcgtcatg
ggcaacaacacccaccggccgaccgacatccatgtgtaccatccctacaggcagccctcc
agcaacaacccttgcaccacacaccacacgacctgcagccacctatgtcttattggcccc
ggtgggaccagcgcttcatgtgagtgtccggaccacttcattggcctgtctgtgggcttc
cagttccagtgcgtggccgactgctccagcacccagttccgctgtggagacaatgagaag
tgtatatccatctggtggaagtgcgatggccagtccgactgtggtgacggatcggacgag
ccgctcacatgcccgcctcgctactgttccattggccagttccagtgccaggacgggaac
tgtacacatcctgcctacctgtgtgacaaacactcagactgccccgacggttctgatgag
gacgccgccctctgcagtgaccacaggtgtgctgagaatgagttccagtgtaaaaacaaa
caatgcattcctgtgtcctggcactgtgacggcttcagcgactgcactgatgggactgat
gaagacatggaggcctgtgcccagaagacgtgccgaccaggacagttcacttgtgccaac
ggacactgtatccagccccaatacgtgtgtgatgttgacaatgactgtggagactggtca
gatgagccgcattggatctgtgttgggccagaacataagtgcgatgagcttacagagttc
tcctgtatttctgactaccgttgtatcccagcctgggctgtttgtgacggcaccaatgac
tgcattgacagcagcgacgagcggaattgtgaggcgttgacctgtgacccactgggagac
ttccgctgtgacaaccacctctgtgtgcccatccgctggaagtgtgacggcagcaatgac
tgtggagatggctctgatgagaggaactgcgtgcccaggccgtgttcggagagtgagtat
cgatgtgacaaccagcagtgcataccaggaaaatgggtgtgtgaccatgacaacaattgt
ggagacaactcggacgagcgcgactgtgagttgcagacgtgtcttcctgggtatttccag
tgcttgtcagggcactgcattcccgctgctctgaaatgtgatggacgaccagactgcctg
gacatctctgacgagagctcctgtccaactcgttacccagggggccgctggtgcccaaac
aatcagtttcagtgtgcaaacaagctgtgtgtgcagcagaactatgtgtgtgatggcgaa
aacgactgtggggaccgttccgatgaggagctccgcttatgtttcaacatctcgtgcgag
atgccatcaaggttccgctgtgctaacggctactgcatctactccggaaacctgtgtaac
cagaaggacgactgtggagatggaagtgacgaaatgccggatgtctgccgagaccccacc
ctggctccttgcacaccccaagagttcaaatgtgtcaacggacagtgtgtggctcagcct
gatgtctgcgaccacattgacaactgtggagacctcactgacgagattggctgtaatgtt
ggtcataaccgcaactgtgaggagaaactttgtcagcacgtgtgtactaacctgaatggg
accggcttcatctgctcctgtagacctggatacaaagttgacccggacagcacctttaag
tgcatagacatcaatgagtgtgagggacacgggacttgcccacagatctgcaagaacact
aagggaggatacgagtgtgtgtgtgccccagggtaccgaaaagtgggtaatggcaacgaa
tgtgaagcggagggtgccgggcctctccttttgctcccagagaatatccgtatccagaag
ttcaacttgcagacggagacctttcatgacttcctggtggaacaggagcacatcattgct
ttggactatgactgggaccataacaacaccggactcagtatggtgtatttcacggtggcc
gcgaaggacgacgctgccgccggtatcaagagggcatatataccgacagtggatgataac
agcaacaacatagccaccgccgtggacctaggcatcaaatacgtgacctcaccagacggg
attgctgttgactgggttggcaggaacctgtattgggccgattcaactatcaagaggata
gaggttgccatgctggacgggcgctacagaaagcatctggtcaagacagacatcggccac
ccctcagctttggctgtcaacccacgattggggatgctgtactgggctgaccgtggaact
gcagccaagattgagtactcatggttggatgggcagcatcggaatgtcctggttccagat
ggcctgggttggcccactggcctgtcaatcgactacgccaacggtgaccgggtgtactgg
tctgatgccaaggagagtcgtattgagtcagtgttaccttctggagaagatcgtcggaca
gcactttacattgacgtgaggaaacctttcagcatcaacgtctttgagaatcacatttac
tggagcacccaggagaaaggggaagtgttccgtcaggacaagtttggccgtggcactaaa
atcaagctgctcacagctggaccctggcttacccagatcagtgtgtaccagcagcagaga
tacaactccatacgcatgaaaagtccatgtaaaggcatctgcagtcacctgtgcctgctc
agacctggaggttacacctgcgcctgccctgagggaacaaactttgtctctggcagtcaa
actgaatgtgatgcaggttttgaacccccacccaccatgccccctctatgccagtgtaca
aatggtggaacatgctactttgacgacagcaaggctctgtgcatatgtccaccagaattt
gaaggcgaattttgcgagattaacgcatttggggtggtggcatcttcagtgggtattgcc
attggggtgactgtagcgatagtaattctcctgggtggtctcgtctacactgcccagagg
aagtccagtatcatggagactatgagacatatcatgcctagtatgcccagcatgccaagc
ttcagaggtttcccgtctcaaagttctgggccatcaaaggaggaggggagtgaactggat
ttaagcctcaaagtggaaaaccttgagaaccctttgtatgctgaacctgatgtggtccat
gtggtagctggccccgagcccaaaactggtgccactcctgcttacatggtctcagtcaag
gaggggacctttggcaatgcagaatgttcttctgactctggtgaggtggtgactcccaaa
gaaccggttgcagacacatcacttaagtttaaactgatccctgacagcgtcgacaacagt
tttataaatccactgttctctgatctcactctaccatccacaccaacagactccttcgtc
tga

KEGG   Esox lucius (northern pike): 105007081
Entry
105007081         CDS       T04894                                 

Gene name
gas1
Definition
(RefSeq) growth arrest-specific protein 1
  KO
K06232  growth arrest-specific 1
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105007081 (gas1)
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 105007081
NCBI-ProteinID: XP_010864167
LinkDB
AA seq 268 aa
MVSLEFFAQRSCRLFWPVGCVFLFFGCLSVASPSHGRRLICWQAIMNCQTEPECHYAYGQ
YTHACAAVLSGDRKKCPSHCISSLVQLNLTKNGPALEDCSCASDSICRNTKRAIEPCLPR
TSNMGCTEARRQCEKDSQCSSAMRDYLIHCGKLFSGATCTNACRNVIADMRKIPKAELLD
TCVCDGTERTICEYVKLSMKNLCFDAPVVAEEGSGSDDEDDEDDEEDFPVLNPVFEGRNA
GSDGCAVGSFGVLTVVTASGLILLTPLL
NT seq 807 nt   +upstreamnt  +downstreamnt
atggtcagtttagagttttttgcgcagagatcctgcaggttgttttggcctgtgggttgt
gtgtttctgtttttcggctgcctatcggtagcctccccctcccacggccgtcggttgatc
tgctggcaggccatcatgaactgtcagacggagccggagtgccattacgcatatggacaa
tacacgcacgcgtgcgctgctgtcctgagcggggatagaaagaagtgtcccagccactgc
atctcctctctggtgcagctcaacctgacgaagaacggccccgcgctggaggactgcagt
tgtgcctcggactctatctgccggaataccaagcgggccatcgagccgtgcctgccccgg
actagcaacatgggctgcacggaggcacggagacagtgtgagaaagactcacagtgcagc
tcggccatgcgagactatttaatccactgcgggaagctcttcagcggggcgacttgcacg
aacgcttgtcggaatgtgatcgcagatatgcgcaaaatacccaaagccgagctgttggat
acgtgcgtgtgtgatgggactgaaaggaccatctgcgagtatgttaagcttagcatgaaa
aacctatgcttcgacgctcctgtggtggcggaggaaggtagcggatcggacgacgaagat
gacgaagatgacgaggaggacttcccagtgttgaacccggtgttcgaggggagaaacgcc
gggtcagatggctgtgctgtagggagctttggtgttttgaccgtggtgacagcgtcaggc
ttaattctactaacgcctcttctctaa

KEGG   Esox lucius (northern pike): 105015340
Entry
105015340         CDS       T04894                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105015340
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 105015340
NCBI-ProteinID: XP_010876732
LinkDB
AA seq 248 aa
MKSWGSALALFSSVLVAIDAQLICWQALLRCHEEPDCELAYSQYLAACEGNIRGIRRQCP
SHCINSLIRLNHTRNGPDLERCDCGQDMECRNEKREIEPCLPRRYSGDAEGIGCTEARQR
CEEDADCHSSLTAYLSYCGQLFNGRKCSSRCKATIQQMLFIPNGMLLNRCVCDGVERPFC
EVVKENMNKLCQIGDHTVSDQADMDDMYEDEDYDSKTEEMYPPDSNSSSLQLSSYMAFLC
ITFTRILY
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaaagttggggcagcgctctggcgcttttctcatccgtgttggtagcgatagatgcc
cagttaatatgttggcaagccctgctccgatgccatgaggagccagactgcgagctagcg
tacagtcagtatctggctgcctgcgaaggaaatatcagaggtatcaggagacaatgccct
agtcactgtataaactcgttgattagactgaatcacacacgtaatgggcctgacctcgag
aggtgtgactgtggccaggatatggagtgtagaaatgaaaagcgggagattgagccatgc
ctccctcggaggtattccggagacgcggagggtattgggtgcacagaggctcgtcaacgc
tgcgaggaggacgccgactgccactcctccctgacagcttacttgtcttactgtggacaa
ctcttcaacggcaggaaatgctcgtccaggtgcaaggccacaatacaacagatgctattc
atcccaaatggcatgctgcttaaccgatgtgtgtgcgacggggtagaaaggccgttctgt
gaggtggtcaaggagaacatgaacaaactgtgccagattggagaccacactgtttcagac
caggcagatatggatgatatgtatgaggacgaagactatgattcgaagacagaggagatg
tatccacctgattcaaattctagttctttgcagctttcgagctatatggcctttttatgc
atcacttttacacggatattatattga

KEGG   Esox lucius (northern pike): 105021964
Entry
105021964         CDS       T04894                                 

Gene name
boc
Definition
(RefSeq) brother of CDO isoform X1
  KO
K20020  brother of CDO
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105021964 (boc)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 fn3 ig V-set C2-set_2 Pur_ac_phosph_N Ig_5 Ig_4 G6B
Other DBs
NCBI-GeneID: 105021964
NCBI-ProteinID: XP_028972156
LinkDB
AA seq 1084 aa
MTSAYSENFRLYGWAQKAEGGIVWKMSGALDWTPWMKKRRVRGLCALGAVLLCCLQGGDS
VNGATGEVPVFTEEPLSVVQKLGGSVTLRCSARPAATNISWRLNGRELDGDLGVVVGPGT
LVIPALTNLTLGRYQCVASTNAGALASVPANVTAAKLRDFEPDDQQDIEVDEGNTAVIEC
HLPESQPKAQVRYSVKQEWLETSKGNYLIMPSGNLQIANATLEDEGPYVCAAYNPVTQEV
KTSTSTDRLRIRRSTSEAARIIYPPASRSIMVTKGQRLVLECVASGIPTPQVTWAKDGED
LRFHNNTRFLLSNLLIDAAGEGDSGTYVCRADNGVGSEGVATVLYDVQVFEPPQVTVELL
QQEVSWGESVRFSCQARGKPAPSVVWLHNAQPLSATPRHRLSPRILRVINVGPQDDGLYQ
CMAENGIGSSQASARLVTSPAGIPARSGRLPPILRPLSPDKVLREQAPVKPGATGGALTL
DCSELTGQISVAEAPVILSQPRTVKADFYELTWKPRHDGGAPVVEYIVKYRKIEDPPAEW
SSRSLSGSLHKLTLAKLQPASLYEVEMSAKNCAGLGQPAMMTFRTGKGRRGPGGQNEPPK
TPPVPSPRLSPPEAPDKPTISMATETSAYVTWIPRGNHGFPIQSFRVEFKKLKGKGGGEW
EVAVANIPPQRLSVEITGLEKGTSYKFRVLAVNVIGASPPSAPSKAYTVVGGGRPNERPV
DGPYITYNEAINETTIILKWTYTAVNNTPIYGFYIFYRPTDSDNDSDYKKDVVEGDRYWH
SITDLQPETAYDIKMQCFNEGGESEFGNVVILETKARLIQRPSPSETSSHRPVHPGGPVP
RPSDLPYLIVGVVLGAMVFIIVAFIPFCLWRAWAKQKQTSDLCFPAMASPVPSCQYTVVP
LQGLALVGHCPLDPHLPLRHAAYPNGDYTPNGKHHHPTRCLPGLNQDEVACDMECDSLLS
QTNGQGPGYRYSNSEPEYRRHDGCLPDDSTLQLLNPSERLISGRNLAGKEHVYNGHVVKE
DDESQDILPRSPSLLLSLQEENSTATTSTATTPESHDALPLQEVNTLQSETVTEGQVMSD
TTEA
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgacgtctgcctattccgagaacttccgcttatatggctgggcacagaaagctgaaggg
ggtattgtatggaaaatgtctggagcgttagactggactccctggatgaagaagcggcgg
gtgcgagggctgtgtgccctgggtgcagtgctgctgtgctgcctgcagggcggagacagt
gtcaacggggccactggtgaggtgccagtgttcaccgaggagcctctgtcggtggtccag
aagctaggcggaagcgtgaccctgaggtgcagcgcccgacccgccgcgaccaacatcagc
tggcggctgaacgggcgcgagctggacggggacctgggggtggtggtggggcccggcact
ctggttatcccggccctcaccaacctgaccctgggccggtaccagtgcgtggccagcact
aacgccggggccctggccagtgtaccagccaacgtcaccgccgccaagctgcgggacttt
gagccagacgaccagcaggacatcgaggtggacgagggcaacaccgcggtgatcgagtgt
cacctcccggagagccagcccaaggcccaggtccgctacagtgtcaagcaggagtggctc
gagacctccaaaggaaactacctgatcatgccgtcggggaacctgcagatagccaacgcc
accctggaagacgaggggccctacgtgtgtgctgcttataaccccgtcacacaggaggtc
aagacctccacctccaccgaccgcctgcgcatacgccggtctacatctgaggctgcccgt
ataatctaccccccggcgtctcgctccatcatggtcactaagggccagcgcctggttctg
gagtgtgtcgctagcggcatccccacgccgcaggtcacatgggccaaggacggcgaggac
ctgcgtttccacaataacacgcgcttcctgctcagcaacttgctgatcgacgcggccggc
gaaggcgactccgggacgtacgtgtgccgcgcggacaacggcgtgggatcagagggcgtg
gccaccgtgctgtacgacgtccaggtgtttgagcctccccaggtgaccgtggagctcctg
cagcaggaggtgtcctggggggagagcgtgcgcttcagctgccaggccaggggtaaaccc
gccccctcggtggtgtggctccacaacgcccagcccctgagtgccacgccacgccaccgc
ctgtccccccggatactgcgtgtcatcaacgtgggcccgcaggatgacggcctgtatcag
tgcatggcggagaacggcatcggcagctcccaggcgtccgccaggctcgtcacctcgcca
gccggcatcccggcgcggtcggggaggctgcctcccatcctgcgtccacttagcccggac
aaggtgctgcgggagcaggccccggtgaagcctggggccacgggtggcgcgttgaccctg
gactgctctgagctgacagggcagatctcggtggcggaggcccctgttatcctcagccag
cccaggaccgtcaaggcggacttctatgagctgacctggaaacctcgtcatgacggaggg
gctcctgttgtagagtacatcgtcaagtacagaaagattgaggaccctccagctgagtgg
agcagccgcagtctctctgggtctctccacaagctgaccctggccaaactgcagccggcc
agcctgtacgaggtggagatgtctgctaagaactgtgctggcctgggacagccagccatg
atgaccttcaggacaggaaaaggtcgcaggggtccaggagggcagaacgagcctcctaaa
acgcccccggtgccatcgccgcgcctctctcctcccgaggcccctgataagcccaccatc
tccatggcgacagagacgtctgcatacgtgacttggatcccgcgcggtaaccacggtttc
cctatccagtcgttccgggtggagtttaagaagctgaagggcaagggagggggggagtgg
gaggtggccgttgctaacatccccccccaacgtctgtcagtggaaatcaccggcctggag
aaaggaacgtcttacaagttccgagtgttggcggtgaatgtgatcggcgccagcccgccc
agtgccccctccaaggcctacaccgtggtgggcggcggcagacccaacgagcgccctgtg
gacggaccgtacatcacttataatgaagccatcaacgagaccaccatcattctgaaatgg
acgtacacggctgtgaacaacactcccatctacggcttctacatcttctaccggccgacg
gacagcgacaacgacagcgactataagaaggacgtggtggaaggtgaccggtactggcac
tccatcaccgacctgcagccagagaccgcctacgacatcaagatgcagtgcttcaacgag
gggggggagagcgagtttggcaacgtggtcatcttagaaaccaaagctcgtctgatccag
cggccctctccgtccgagacgtcttcccataggccagtgcatcctggggggcctgtgccc
cgccccagtgacctcccctacctcatagtgggcgtggtcctgggagcaatggtcttcatc
attgtggcgttcatccccttctgcctgtggagagcctgggccaaacagaagcagacctca
gacctgtgtttcccagccatggcatcccctgtgccctcctgccagtacactgtggtgccc
ctgcagggcctggcgctggtgggccactgcccgctagacccccatctgcccctccggcat
gccgcctaccccaatggagattacacccctaacgggaaacaccatcaccccacacgctgt
ctgcccgggctaaaccaggatgaagtggcgtgtgatatggagtgtgactccctgctgagc
cagaccaacggacagggcccgggctaccgctactccaacagcgaaccggagtatcgcaga
cacgacggctgtctgccagatgactccacgctccagctcctcaacccctcggaacggcta
atcagcggccggaacctggcagggaaagaacatgtttacaatgggcacgtcgtgaaagag
gatgacgagagtcaagacatcctaccacgctccccctcccttctcctatcactacaggag
gaaaattccacagcaacaacatcaacagctactacgccggaatcccatgatgcacttcca
ctccaggaagtgaacaccctccagagtgaaacagtgacagaaggacaagtgatgtcagat
acgacggaagcttga

KEGG   Esox lucius (northern pike): 105022500
Entry
105022500         CDS       T04894                                 

Gene name
lrp2
Definition
(RefSeq) low-density lipoprotein receptor-related protein 2 isoform X1
  KO
K06233  low density lipoprotein-related protein 2
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105022500 (lrp2)
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    105022500 (lrp2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 SGL EGF_CA hEGF
Other DBs
NCBI-GeneID: 105022500
NCBI-ProteinID: XP_019910606
LinkDB
AA seq 4702 aa
MRSWTDQPGPSIRMWRAVLAKLLVILILCTFRCHSQGCETGQFRCRSGRCIPNDWHCDGT
SDCVDNSDEADCPHVTCDQSHFQCLSDGECIPGVWVCDDEEDCEDGSDERQHCPGRTCSS
GQFSCSNGVCIPGEYRCDRLPDCSDGADERNCHYPECVELRCANGACYNQSQRCDRALDC
RDGSDEANCTQHCINGQFQCGNGECIPQRYACDHDDDCGDGSDELSCTYPTCRGSYFTCP
SGRCIHQVWLCDGEDDCEDNADEKGCDAVPRECYPGEWPCPSSGLCIPMEQLCDGTPQCP
DGEDETNITAGRNCSIWRCASLSCEHRCHASPAGGTCSCPPGYVVNNNNSRSCVDFEDCQ
MWGVCDQLCEDRIGSHHCSCREGYFLEQHRYCRANITTGVATLVFSNGRDLLIGDINGHS
SRTLVHSQNRGVAVGVDFHYLLNRVFWTDTIQNKVMSVDMDGSNMQVVLNVSVDYPENLA
VDWVNNKLYVVEASVNRIDMVDFDGANRVTLIAENLGNPRGLAVDPTVGFLFFSDWESLN
GEPGLERAYMDGTNRYGIIKTKLGWPAGITLDIDAKRVYWVDSRYDYIETTTYDGLHRRT
VVHGGALIPHPFGISLFEHSVYFTDWTKMAVMKANKFSDTSPQVVYTTSQTPHGVQVIHR
LRQPYVTNPCGADMGGCEQICVLSHRSDNQGLGYRCRCRMGYDLHADGKRCVAVRQFLLF
SSQLAVRGIPFNLSSQEDVILPVTGTPSYYVGVDFSAEDDSIFFSDTAKDIIYKQKVDGT
GREVLAANRVDGMEDLAYDWISKNLYWTDPRYRSISVMKLADKSRRAIVRNLNNPRSIVV
HPVIGYIFWTDWYRPAKIMRAWCDGSHALSIVNTTLGWPNGLAIDWSSMRLYWVDAFFDK
IEHSTFDGQNRLSLGRITQISHPFGLTIFGGYAYFTDWRLGGIVRVRKTDGGELMVIRRG
ISHIMHVKSFNSNSQTGSNFCSMFTNPNGDCSHFCFPAPDSQRVCGCPYGMKLAPNQQTC
VEDPSNEPPTLQCGANSFSCANGKCVPRNYRCDGVDDCHDNSDEANCGGVHNTTCSPRAF
TCASHQCVPSAWRCDGHNDCFDGSDERDCPTQTPGTCTAGQFTCANHHCIPRTWLCDTDN
DCGDGSDEVDCDLSGTCHPEQFQCPDHRCIGPSYVCDGDRDCVDGADEQGCIYNCTVFEF
KCSSGHQCVNSYYRCDGVFDCSDRSDESGCQGREPLPATRPPGMCHHETEFQCQSDGSCV
PSGWECDGHPDCEDGSDEHHVCPPRTCPSALFRCDNGNCVYRGWLCDGDNDCRDMSDERD
CPTPPFHCPSWQWQCPGHSVCVNITRVCDNTPDCPNGADESPLCNEPLPDQESCTDNNAG
CTHGCIQGPFGAQCTCPVGYQLSNDSKTCDDMDECFPPGLCSQHCHNERGSFRCHCSDGY
TLEADQRTCKVSDSREAVLLVASRNQIVSDDITTQPNVVRSLVRDGRNIVALDFDSVTDR
VFWSDTSQDKIWSAHKNGSDRIVVFDSGVTVTESLAVDWVGRNLYWTDYVLETVEVAKLD
GTHRTVLVSENVTNPRALVLDPREGVHLMFWTDWGRNPRIERASMDGKNRMTIVSNKLYW
PNGITIDYPNNLLYFADAYLDFIDYCDYNGTNRKQVLASDLVLQHPHAITIFEDFVYWTD
RYVNRVIRANKWHGENQTVMLYNLPQPMGLVVLHPARQPAGENHCLRSPCTHICLLSAVG
PSFFSCACPSGWNLAADQVTCARVEDPFLVVVRDSIIYGISLKPEDKSNDAMVPVAGLQN
GYDVDFDDNEQTIYWVEHPGEIHRVKSDGTNRTEFAPAAILGSPVGLALDWMTENLYYTN
PATQSIEVLRLRGEVQYRKTLITNNGSPTGAGSPVGIAVDPARGKLYWTDQGTERGIPAK
VASADMDGSNPATLFTDNLDHVEFITVDIRENKLYWAVTGTGKIERGDPDGTNRITMVTG
LSHPWGVAVYDSHLYFTDRDFEVIERVDKATGANRVILRDNVSGLRVLKVHFRETSAGTS
NGCSNNVGACEHLCLPRPGMLFSCACATGFKLNGDSRTCAPYQSYVVISMLSALKGFSLE
GADHSEAMVPVAGRGRNALHVDVHMSSGFLYWCDFSSTAASQNGIRRIKPDGAGFRSVVT
SGIGRNGIRGIAIDWAAGNLYFTNAFLTETYVEVLRLNTTFRRVLLKTQVDMPRHIVVDP
KNRYLFWADYGQNPKIERALLDGSNRTVLVSSGIITPRGLALDYQTGYIYWVDDSLDMIA
RVNPQGGETEIVRYGSRYPTPYGIAVFETSIIWVDRNLKKVFQASKEPGSTEQPAVIRDN
VNMLRDVTIYDQRTQATSAQQLNNNPCLDANGGCAHFCFALPGAQNKRCGCAFGNLGADN
AGCVVSRDDYLIYTTESTVRSLRLDPEDHALPFPVVNVPRTSVALDFDRTDNRIYFTQSS
GAGSSKISYIGLSSPTSPPVVVASDLGAPDGIAYDWINRRIYYSDYVNQTISSMAVDGTQ
RTIIAHVPRPRAIMLDPCRGYMYWTDWGTNAKIERATLGGNFRTEVVNSSLVWPNGLTLD
YEEQRLYWADASLQKIERCSLTGANREVIVGTAIYPFAMTMYGQYIYWTDWNTRSIYRAN
KHDGSDQLVMTQNLPSRPMDIHVLASNKQQQCSSPCQQFNGGCSHICTPGPQGAECQCPA
EGLWYLADNKHCIPDNGTRCQAGQFTCMNGRCIRAQWKCDNDNDCGDGSDELERVCGPKN
DFQPFVQVPMVASFIALSAFHTCEPSVFTCGNGRCVPYHYRCDHYNDCGDNSDEVSCLFR
PCDPNTEFPCNNGRCIAHDYVCNGINNCFDNGTSDEQNCPERTCQPEHTKCASTNICIPR
SYLCDGDNDCGDMSDESPTHCATSTCAQSEFRCSSGRCIPAHWYCDGGTDCADGSDEPSS
CTTLVRTCNSDQFRCDDGRCIASSWICDGDNDCGDMSDEDQRHSCANRTCSALEFTCVNN
DAQQRKCIPRDWVCDGDADCADALDEHQNCTRRSCGLNDFTCSNGLCIRSSYRCDRRNDC
GDSSDEQACSYQPCQQHQFTCQNGRCVSRDFTCDGDNDCGDDSDELETLCRTPTTTCPPG
QFQCDNGHCVPLFKVCDRSDDCSDNSDEKGCGINECTDPSMHHCDHNCTDTPTSFVCTCR
PGYRLMSDGKSCDDIDDCSETPSVCSQVCENTVGSYVCKCAPGFLREPDGRSCRQNSDIT
PYLIFSNRYYLRNLSTDGEAYSLILQGLTSVVAMDFDRVDRRFYWIDVSRRVIERMLYNG
SDREVVVNGVLHGEGLAVDWVARKLYWVDSFLDCLKVSELDGRFVRKLAEHCADANNTYC
FENPRAIVLHPKYGYVYWTDWGDKAFIGRVGMDGTNKTAIITTKIEWPNGVTIDYSNDKL
YWSDAHLNYIEFSDLEGHHRHSVYDGTLPHPFALTVFEETVYWTDWNTRTVEKGNKYDGS
GRQALVNTTHRPFDIHVCHPYRQPIVTNPCAVNNGGCSHLCLIRHGGRGHTCECPDHFLT
VQLGGVARCLPMCTSTQYRCADNERCIPIWWKCDGQRDCRDGSDEPSTCPSRHCPLGQFQ
CNDGNCTSPHFLCNSNQDCHDGSDEDPVLCVTHQCETHQWQCTSKKCIPEAWQCDGEDDC
GDGSDEEPAHCSSRTCRPGQFKCRNGRCIPQSWKCDVDDDCGDNSDEPLEECMGPSYRCD
NHTEFACRTNYRCVALWSVCNGHNDCRDNSDEQSCEALTCDPLGDFRCDNHQCVPLRWRC
DGDNDCGDGSDERACSPRVCSESEFRCDNLNCIPDRWVCDHDNDCEDNSDERDCELRTCH
PGYFQCGSGHCIADRFKCDGNADCLDYTDEISCPTRYPNGTYCPPFLFECRNHVCVQQYW
KCDGDNDCGDSSDEELHLCLDIPCDPPFRFRCDNNRCIYSHELCNSVDDCGDGTDEREQH
CQTPTHGPCSTEEFKCSNGQCIPLQYACDDYDDCGDHSDELGCNHGSGRSCSENICEQNC
TNLTDGGFLCSCRPGYKPSQTNRNDCEDVNECEVFGTCPQECKNSKGSYECFCAQGFRSV
SEQHGVECAAEGNPPVLLLADNVRIRRFNLSSGQYSDFVDNAEHIQALDYQWDPEGIDFS
VVHWTVLGRGNEFGSIKRAYMPTFNDNGNNPVKEVDLNLKYVSNPDGIAVDWIGGHIYWT
DAGTNRIEVAKLDGRYRKWLIYTDLDQPAAIVVSPATGMMYWTDWGRRPRIESSWMDGQH
RQVLLDEDLGWPTGLALDYLNGNRIYWCDSKENIIESMKPDGTERKIIMSGDIGKPYSLD
VFEGHVYWSTKERGEVWKTEKFGKGDKVKVLTVNPWLTQVRVYQEHRYSRSVPNPCKDVC
SHLCLLRPGGYTCACPQGSSPVDFNPNVCDAAIETQVDMFTPCRCVNGGTCYTDEGGLLK
CKCPYSYAGSYCEIGKSRGAPAGTAIAVLLAVILILITGALAVGVFLNYKRTGSLIPPMP
KLPSLSSLVKSGDTGNGVTFRSGDNVTMDLGPPPIGVSFIDRANQLDESFAESGRQPITF
ENPLYATVAAGLPSDPAVIHASQVTVTVGGEQIQNNFTNPAYHKEQRVSTVDRSIIQAKP
VQQSRWSFFKRKLKPSTTFENPTYSEMQNEKAVGSNENSSSTEPSPFGPPIKPLKRDHPS
TYSPTEDTFRDTANLVKEDSDV
NT seq 14109 nt   +upstreamnt  +downstreamnt
atgaggagctggacggaccagccgggacctagtatcagaatgtggagagcagtgcttgca
aaacttcttgtaatattgattttgtgtactttccgttgtcattcacaaggttgtgagacg
gggcagttccgctgtaggtccgggcgatgcatcccaaatgactggcattgtgatggaacg
tcagattgcgtagacaactcagacgaagccgactgccctcatgtaacatgtgaccagagt
catttccagtgtttgagtgatggggagtgcatcccaggtgtctgggtttgtgacgacgag
gaggattgtgaggacggctcggatgagagacagcactgccctggtcggacgtgctccagt
gggcagttcagctgcagcaacggggtctgtatcccaggggagtacaggtgtgaccgactg
cccgactgctccgacggggccgatgagagaaactgccactaccccgagtgtgtagagctg
agatgtgccaatggagcttgctacaatcagagccagcgctgcgaccgggccttggactgt
cgcgacggatcagacgaggccaactgcacacagcactgcatcaacggccagttccagtgt
ggcaacggcgagtgtatccctcagcgctacgcctgcgaccacgacgacgactgcggagat
gggagtgacgaactgagctgcacttatcccacctgcagaggaagctacttcacatgcccc
agcggtcgctgtattcaccaggtctggctttgtgatggggaggacgactgtgaagacaat
gcagatgagaaaggctgtgatgccgtgccccgtgagtgctacccgggagaatggccctgt
ccatcctcgggcctgtgcatccccatggaacagctatgtgacgggacacctcagtgtcca
gacggagaggatgagaccaacatcacagccggacgcaactgtagtatttggaggtgtgcc
tctctgagctgcgagcatcgctgtcatgcgtcccccgcgggagggacctgctcatgtcct
cctggatatgttgtgaacaacaacaacagccgttcctgtgttgattttgaagactgtcag
atgtggggtgtctgcgatcagctctgtgaagacaggataggatcccatcactgcagctgt
cgagaaggctattttctggagcagcaccgatactgcagagctaacattacaactggagtg
gccacactagtgttctccaatggtcgtgatctgctgattggtgacatcaatggacacagc
tcacgcaccctggtccattcccaaaacagaggagttgctgtgggggtggacttccactac
ctcctcaacagggtcttctggacagatactattcagaacaaggtgatgtcggtggatatg
gacggttccaacatgcaggtggttttaaatgtatcagttgactaccctgagaacctggcc
gtggactgggtgaacaacaagctgtatgtggtggaagccagcgtcaaccggattgacatg
gtggattttgacggcgctaaccgggtcacgctgattgcagagaacctgggaaaccctaga
gggctggctgtggaccctactgtcgggtttctgttcttctcggactgggagtctctcaat
ggggaaccaggtttggagcgagcttacatggatggcacaaatcgctatggaatcatcaag
actaaactgggctggccggctgggatcacactggatattgatgcgaagcgcgtttactgg
gttgatagccgctatgactacattgaaaccactacatatgatggccttcataggagaacc
gtggtccacgggggtgccctgatcccacacccctttggcatcagtctctttgagcactct
gtgtatttcaccgactggaccaagatggctgtgatgaaggccaacaagttcagtgacact
agccctcaggtggtctacacgacatcccagaccccacacggagttcaggtgatacaccga
ctaagacaaccgtacgtgaccaacccttgtggtgcagacatgggtggatgtgaacagatc
tgtgttctaagccaccggtcagacaaccaagggctaggctatcgctgcagatgtcgcatg
ggctacgacctgcatgcggatggcaagagatgtgtggcggtgaggcagttccttctcttc
tccagtcagctggctgtccgaggtatccccttcaacctgtcctctcaggaggatgtcata
ctcccggtcacgggaacaccctcgtattacgttggggtggacttcagcgcggaggacgac
tccatcttcttctcagacacggccaaagacatcatctacaagcagaaagtggatggaacc
ggcagggaggtgctagcggccaatagagtggatggcatggaggacttggcttacgactgg
atttcaaagaacctctactggacggacccgcgctacaggagcatttcagtcatgaagctg
gccgataagtccaggagagccatcgtacgcaacctgaacaatcccaggtccatcgtggtg
caccctgtgattgggtatattttctggacagactggtaccgtccagcaaagattatgaga
gcctggtgtgatgggtcacatgccctgtcaattgtaaacactactcttggctggcccaat
ggcctggctatcgactggagctccatgcgcctgtactgggtggatgccttttttgataag
atcgaacacagcacctttgacggacagaacaggctgtctctgggccgcatcacccagatc
tcacatccttttggactcactatttttggagggtacgcgtatttcaccgactggcgcctc
ggtgggatcgtgcgtgtgcgcaagactgacgggggagagctgatggtcatcaggagggga
atcagccacatcatgcatgtcaaatctttcaactccaactcccaaactggttccaacttc
tgcagcatgtttaccaaccctaacggcgactgcagtcatttctgcttcccggccccggac
tcccagagggtgtgtggatgtccatatggcatgaagctggcgcccaaccagcagacgtgc
gtggaggatccttccaatgagcccccaacgctgcagtgtggcgccaactccttctcctgc
gccaatgggaaatgtgtccctcggaactacagatgcgacggcgttgacgactgccacgat
aacagtgatgaggccaattgcggcggagttcataataccacctgctcccccagggcattc
acctgtgccagccatcaatgtgtgcccagcgcctggcgctgcgacgggcacaatgactgc
ttcgacggcagtgatgagcgggactgccccacccagacgcctggcacctgcaccgccggc
cagtttacctgcgccaaccaccactgcatcccacgcacctggttgtgcgacacggacaac
gactgcggggacggctcggacgaagtcgactgcgatctcagcggtacgtgccacccggaa
cagttccagtgtccagaccaccgctgcatcggccccagctacgtgtgtgacggggaccga
gactgcgtggatggtgctgacgagcaggggtgcatttacaactgtacggtcttcgagttc
aagtgctccagtgggcatcagtgtgtcaactcctactatcgctgtgatggggtgttcgac
tgtagcgatcgctctgatgagtccggctgccagggtcgcgagcccctaccagccaccaga
ccaccgggcatgtgccaccacgagactgaattccagtgccagtctgatggcagctgtgtc
ccctccggctgggagtgcgacggccaccctgactgtgaggacggctcggacgagcaccac
gtctgcccgccgcgcacctgcccctcagccctgttccgctgtgacaacggaaactgcgtg
taccgcggctggctctgcgacggcgacaacgactgcagggacatgagcgacgagagggac
tgccccacgccgccgttccactgccctagctggcagtggcagtgcccgggccacagtgtg
tgtgtcaacatcaccagggtgtgtgacaacacccctgactgtcccaacggtgcagatgag
tccccgctctgcaacgagcccttgccagatcaggagagctgcacggacaacaacgcaggt
tgcacccacgggtgtatccaggggccgttcggggcccaatgcacatgccctgtcggctat
cagctgagcaatgactccaagacgtgtgatgacatggacgagtgtttccctcctgggctg
tgcagccagcactgccacaacgagagaggctccttccgctgtcactgctcggacggatac
actctggaggctgaccaacgcacgtgcaaagtctcagattcacgcgaggctgtcctgtta
gtcgccagccgaaatcagatcgtgtccgatgacataaccactcagcccaatgtggtccgt
tcgttggtccgggatggacgaaacattgtggcgctggactttgactctgtgactgaccgt
gtgttctggtctgataccagccaggacaaaatatggagcgctcacaaaaatggcagcgac
aggattgtagtttttgacagtggagtgacggtgacagagagcctggcagtggactgggtg
ggccggaacctatactggactgactatgttctggagaccgtcgaggtggccaaactggat
ggcacacacagaaccgtgttggtcagtgagaatgtgaccaatcccagggccctggttctg
gatccgagggaaggagttcacctgatgttctggacagactgggggaggaaccctcgaatt
gagagggccagtatggacgggaaaaataggatgaccatcgtaagcaacaaattgtactgg
cccaacggcataaccattgactaccccaacaatctgctgtacttcgctgatgcctatctg
gacttcattgactattgtgattacaatggcaccaacaggaaacaagtacttgctagtgat
ctggtactgcaacatccccacgcaattaccatttttgaggattttgtgtattggaccgac
agatatgtcaaccgcgtgatccgagccaataagtggcatggggagaaccagacggtgatg
ctctacaaccttcctcagcccatgggcctggtggtgttacacccggcccggcagccagca
ggtgaaaaccactgcttgaggagcccctgtactcatatctgtctgctctctgccgtggga
ccaagcttcttctcctgtgcctgcccctcaggctggaacctggctgcagaccaagtcacc
tgcgccagagttgaggatccgttcctggtggtggtgagagacagtatcatctacggcatt
tctttaaaaccggaggataagagcaacgatgccatggtgcctgtagccgggcttcagaac
ggatacgacgtggattttgacgacaatgagcagaccatctattgggtggagcacccgggt
gagatccacagggtgaagtcggacggcaccaaccggacagaatttgcccctgcagccatt
ctgggctccccagtgggcctggccctggattggatgacagagaacctgtactacaccaac
ccagccacacagtcaattgaggttttgaggctaagaggggaggtgcagtacagaaagacc
ctaatcaccaataatggctccccgactggtgctggcagcccggttggcattgctgtggac
ccggcgcgtgggaaactgtactggacagaccaaggcacggagagaggaatcccggctaag
gtggcgtcggccgacatggacgggtccaacccagccaccctgttcactgacaacctggac
cacgtggagttcattactgtggacatcagagagaacaagctgtactgggctgtgacaggc
acaggaaagattgagcgcggcgacccggacgggaccaatcgcatcactatggtgacaggc
ctgtcccacccgtggggtgttgctgtgtatgacagccacctgtacttcactgaccgggac
tttgaagtgatcgagcgcgtggacaaggccaccggcgccaacagggtgatcctgcgggac
aacgtgtctggactcagggtgctgaaggtccacttcagggagacttcggcgggtacctcc
aacggctgcagcaacaatgtcggtgcgtgcgagcatctgtgcctcccgcggcccgggatg
ctgttcagctgcgcgtgtgccacaggcttcaagctcaacggcgacagcaggacctgcgct
ccttaccagtcgtacgtggtcatctccatgctgtcggccctcaaaggcttcagtctggag
ggggctgaccactctgaggccatggtgcctgtggctgggagaggccgtaatgcccttcac
gtggatgtccacatgtcctccgggttcctctactggtgtgacttcagcagcaccgcggcg
tctcagaacgggatccggcggatcaagcccgacggagccggcttccgtagtgtggtcacg
tctggaatcggtcgcaacgggataagagggatcgccatagattgggccgcagggaacctc
tatttcaccaacgctttcctgacagagacttatgtagaggtcctgcgcctgaataccaca
ttccgacgggtgcttttgaaaacccaggtggacatgccacgccacatcgtggtggacccc
aaaaacaggtacctgttctgggccgattacggacagaaccccaagattgagcgtgctctg
ctggatgggtccaaccgtacagtgctggtgtcgtccggcattataaccccacgaggtctg
gcacttgattaccagactggatacatctactgggtggatgactctctggatatgatagct
cgggtcaacccccaggggggcgagacagaaatagttcgctacggaagccgctaccccact
ccctatgggatcgctgtgtttgagactagcatcatctgggtggaccggaacctgaagaag
gtgttccaggctagcaaagagcctggcagtaccgagcagcctgccgtgatccgagacaac
gtcaacatgctgagggacgtgaccatctacgaccagcgcacccaggccacctctgcccag
cagctcaacaacaacccgtgtctcgacgccaacggaggctgcgcccacttctgctttgcc
ctccccggtgcccagaacaagaggtgcggctgcgccttcgggaacctgggggcagacaac
gcgggctgtgtggtgtcgcgggacgattacctcatctacacgacggagagcactgtgcgg
agcttgcgtctggacccggaggaccacgctctgcccttccccgtggtcaacgtgccccgt
acctctgtggccctggactttgaccgcactgacaacaggatctacttcacccagagctca
ggggctgggagcagcaaaatcagctacatcggtctgtcgtctcccacctcgcctcctgta
gtggtggcctcagatctcggggctcctgatggtattgcctatgactggatcaatagaagg
atctactacagcgactatgtcaaccagactatcagctccatggcagtggatgggactcag
aggaccatcatcgcccatgtgccccggcctagagccataatgctggatccctgcagggga
tacatgtattggacggattgggggaccaatgcgaagattgaacgtgccactttgggaggc
aacttcaggacagaggttgtaaacagcagtctggtgtggcccaatggtctgaccctggac
tatgaagaacaaagactttactgggcagatgctagcctgcaaaagattgagcgctgctct
ctcactggggccaatcgtgaggtcattgtcggcacagccatttacccctttgctatgacc
atgtacggtcagtatatctactggactgactggaacacacgcagcatctaccgagccaac
aagcatgatggctctgaccagctggtcatgacgcagaaccttccatctaggcccatggac
attcatgtcctggccagcaacaagcagcaacagtgcagcagcccctgtcagcagttcaac
ggaggctgcagtcacatctgtaccccagggccccagggtgctgaatgccagtgtcccgca
gagggtctttggtacctggcagacaacaagcactgtatccctgacaacgggacccgctgc
caggccggccagttcacctgtatgaacggacgctgcatccgcgcccagtggaagtgtgac
aacgacaacgactgcggggatggaagtgacgagttagagcgagtctgtggacccaagaat
gatttccaaccttttgttcaagtgccaatggtggcgtcgtttattgccttatcagccttc
catacctgcgagcccagtgtgttcacctgtgggaacggtcgctgcgtgccctaccactat
cgctgcgaccactacaacgactgcggggataacagcgatgaggtaagctgcctgttcagg
ccctgtgaccccaacaccgagttcccctgcaacaatggacgctgcatcgcccacgactat
gtctgcaacggcatcaacaactgcttcgacaacggcacgtcggatgaacaaaactgcccg
gagcgaacgtgtcagccagaacacaccaagtgtgcctccaccaacatctgcatcccccgc
tcctacctgtgtgacggagacaatgactgtggtgacatgagtgacgagagccctacacac
tgtgccacctccacgtgtgcccagagtgagttccgctgctccagcggccgctgtatcccc
gcgcactggtactgtgatggagggacggactgtgctgatggctcagatgagccgtcctcc
tgcaccaccctggtgaggacctgcaactctgaccagttccgctgtgatgacggcaggtgc
atcgcctcttcctggatctgcgacggggacaatgactgcggagacatgagtgatgaggac
caaagacacagctgcgccaaccgtacgtgctccgccttggagttcacctgtgtgaacaac
gacgcgcagcagcggaagtgcatacctcgtgactgggtgtgtgacggcgatgcggactgc
gcggatgcactggacgagcaccagaattgcacgcgcaggtcgtgcggcctcaacgatttc
acctgcagcaacggcctctgcatacgcagctcctacaggtgtgaccggaggaatgactgc
ggtgacagcagcgacgaacaggcctgctcctaccagccctgtcagcagcaccagttcacc
tgccagaacggacgctgcgtgtcccgcgacttcacctgcgacggggacaacgactgcggc
gacgattcggatgaactggagaccctgtgccgaacgccgaccaccacgtgcccccccgga
cagttccagtgtgacaacggacactgtgtccccctcttcaaagtgtgtgaccggtcggac
gactgctcagacaacagcgacgagaagggctgtggtataaatgaatgcactgatccctcc
atgcaccactgtgaccacaactgcaccgacacccccaccagcttcgtctgcacctgtcgc
ccgggctaccgcctcatgtccgacggcaagtcctgcgatgacatcgacgattgctccgag
acgcccagcgtgtgcagccaggtgtgcgagaacaccgtgggctcctacgtgtgcaaatgt
gcccccgggttcctacgggaaccggacgggcgcagctgccgtcagaacagcgacatcacg
ccctacctcatcttcagcaaccgctattatctgcgtaacctgtcgacagacggagaggcc
tactccctcatcctgcagggtttgaccagcgtggtggccatggactttgaccgtgtggac
aggcgcttctactggatcgacgtaagccggagggtcattgagcggatgctgtacaacggc
agtgaccgagaggtggtggtgaacggcgtgctgcatggcgagggcctggcggtcgactgg
gtggccaggaaactctactgggtggacagcttcctggactgtctcaaagtgtcagaactg
gacggccgctttgtgaggaaactggctgaacactgtgcggacgccaataacacttattgc
tttgaaaaccccagggcgatcgttttgcaccctaaatatggatatgtctactggacagac
tggggggacaaagcattcattggccgtgttggaatggacggcaccaacaagacggctatc
atcaccaccaagatagagtggcccaacggtgtcaccattgactatagcaacgacaaactc
tactggtccgacgcccatctcaactacatcgagttctccgacctggagggacatcaccgg
cacagcgtgtacgacgggacgctgccacacccgttcgctctgaccgtctttgaggagacc
gtgtactggaccgactggaacacccgtacggtggagaaaggcaacaaatacgacggttct
ggccggcaggctctggtcaacaccacgcacagacccttcgacatccacgtgtgccatcca
tacaggcagcccatagtgaccaacccctgtgcggtgaacaacggcggctgctcccacctg
tgtctaatccgccacggagggcggggtcacacctgtgaatgccccgaccacttcctgact
gtacagctggggggcgtggctcgctgcctgcccatgtgcaccagcacccagtacagatgt
gcggataatgagcgctgcatccccatctggtggaagtgtgacggtcagagagactgcagg
gacggctctgatgagccctccacctgccccagtcgccactgcccactgggccagttccag
tgcaacgacggaaactgcaccagcccacactttctgtgcaacagtaaccaggactgccat
gatggctctgatgaagacccagtgctgtgtgtcactcatcagtgcgagacccaccagtgg
cagtgcaccagtaagaaatgcatccctgaggcgtggcagtgtgacggggaggacgactgt
ggcgacggctctgacgaggagcccgcccactgctccagcaggacatgcaggcccggacag
ttcaagtgtcgcaacggacgctgcatcccccagagctggaagtgtgacgtggatgacgac
tgtggagacaactctgacgagcctctggaagagtgcatggggccgtcttatcgctgtgac
aaccacaccgagtttgcctgcagaacaaactaccgctgtgtggcattatggtctgtctgc
aacggccacaacgactgcagggacaacagtgatgaacagagctgcgaggcgctgacctgc
gaccccctgggggacttccgctgtgacaaccaccagtgtgtccctctgcgctggaggtgt
gatggggataacgactgcggggacggatcggatgagcgcgcctgcagcccgcgtgtgtgc
tccgagagcgagtttcgctgcgataatctgaactgcattcccgaccgctgggtctgtgac
catgacaacgactgtgaggacaactcagatgaaagggactgtgagttgcggacctgtcac
ccaggctacttccagtgtgggagtggccactgcatcgctgaccgcttcaaatgtgacggc
aatgctgactgcctggactacactgacgagatatcttgtccgacacgttatccaaatggc
acgtactgcccaccgttcctgtttgagtgtagaaaccatgtgtgcgtgcagcagtactgg
aaatgtgacggagacaacgactgtggggacagttctgacgaggagctccatctctgcttg
gacatcccatgtgacccgcccttccgctttcgctgcgacaacaaccgctgcatctacagc
cacgagctctgcaactctgtggatgactgcggcgatggcacggacgagagagagcagcac
tgccaaacccccacgcacgggccctgttcaacagaagagttcaagtgcagtaacggccag
tgcatccccctgcagtacgcctgcgacgactacgacgactgcggagaccattcggacgag
ctgggctgcaatcacggcagtgggcgctcctgcagtgagaacatctgtgagcaaaactgc
accaacctgaccgacggaggcttcctctgctcctgcaggcccggatacaagcctagtcag
accaacaggaacgactgcgaggacgtgaacgagtgcgaggtcttcgggacgtgtccgcag
gagtgtaagaactccaagggcagctacgagtgcttctgtgcccagggtttccgctcggtc
agcgagcagcacggcgtggagtgtgctgccgaaggaaacccaccggtgctgcttctggct
gacaacgtgcggattcggcgtttcaacctgtcctcaggacagtattccgacttcgtggac
aacgcagagcacatccaggctctggactaccagtgggatccagagggcattgatttcagt
gttgtgcactggacggtcctgggccgaggcaatgagtttggctctatcaagcgggcctac
atgcccacgttcaatgacaacggcaataacccggtgaaggaggtggatctgaacctgaaa
tatgtttccaaccctgatgggatcgctgtggactggattggaggtcacatttactggaca
gacgcagggaccaatcgaattgaagtggcgaagttagatggtcgctacaggaagtggtta
atatatactgacctggaccagcctgctgctattgttgtcagcccagcaactggaatgatg
tactggacagactggggcaggagacccagaatcgaatccagctggatggacgggcagcac
aggcaggttctgttggacgaggacctgggctggcctactggcctggctctggactacctg
aacggaaacaggatctactggtgtgactccaaggagaacatcatagagtccatgaagcca
gacgggacggagaggaagatcatcatgtcgggagatatcggcaaaccctacagcctggac
gtcttcgagggccatgtgtactggtcgaccaaggagcggggcgaagtgtggaagacggag
aagttcggaaagggggacaaagtcaaggtgctgaccgtcaacccctggctgactcaagta
cgcgtctaccaggaacacagatacagccgatcagtacccaacccctgcaaggacgtgtgc
agccacctgtgtctgctgcgtcccggcggctacacctgcgcctgccctcaggggtcctcc
ccagtcgacttcaaccccaacgtatgcgacgcagccattgagactcaggtcgacatgttc
actccatgcagatgcgtgaacggtgggacctgctacactgacgaggggggcctgctcaaa
tgcaagtgtccgtatagctatgcaggaagctactgtgaaatcgggaagtccaggggtgcc
cccgcaggaacagcgatcgctgtacttttagcggtgatcctcatcctcatcacgggagcg
ttggccgttggcgttttcctcaactacaaacgaacggggtccctaatccccccaatgccg
aaactacccagcctgagcagtctagtaaaatctggagacactggcaacggggtgacgttt
cgctcgggtgacaacgtcaccatggatctgggacctccacccatcggggtgtcattcatt
gacagggccaatcagctggatgagagctttgcggagtcagggaggcagccaatcacattt
gagaaccctctgtatgctacggtagcagctgggttgcctagtgatcctgctgtcatccac
gcctcacaggtgactgtcactgtaggcggggagcagatacagaacaactttacgaaccca
gcgtaccataaagaacagagagtgagcactgtagaccgctccataatccaagccaagcct
gttcagcagtcaaggtggagttttttcaaaagaaaattgaagccgagcacaacttttgaa
aaccccacctattccgagatgcaaaatgaaaaagcagtaggaagcaatgagaacagttcc
tccactgagccatctcccttcggccctcccatcaaacccctgaagagggatcatcccagc
acctactcaccgacggaagacactttccgagacacagcaaaccttgtcaaagaggacagc
gatgtataa

KEGG   Esox lucius (northern pike): 105028514
Entry
105028514         CDS       T04894                                 

Definition
(RefSeq) cell adhesion molecule-related/down-regulated by oncogenes
  KO
K20033  cell adhesion molecule-related/down-regulated by oncogenes
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105028514
SSDB
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig V-set Pur_ac_phosph_N Ig_4 Herpes_gE
Other DBs
NCBI-GeneID: 105028514
NCBI-ProteinID: XP_028977683
LinkDB
AA seq 1154 aa
MTAGRRVLSTVLCLSHALLLSSSAVASLSFLSEPTSVVQIQGSDVELRCSAQPNSSGLSL
SWRFRGRPLDPASVPGVELTPSGGVLSLYPLQAVHQGLYQCVAQSDTGAIISRYARVAIA
DIAEYGETQRRSLVVQEGSSVVIQCPLPPSAPPAVPRVRVRGEWLENSTDNYIVVPSGNL
QILSVSPRHGGIYKCGAYNPVTKENRVEGHGTKLTVKPADNPSPARIVYPIVPTTVSAEP
SATLVLECVVSGSPMHPAIWLKDGRELAAPARGPREHNNLVLLDLRRSDSGIYQCSVQTE
KGTLLSVNYTVNVLEEASVLRGLTDQSVSSGDSARFNCLAKGNPTPGVTWLFNASPIAPS
TRLRISGSTLIISRVTLKDEGVYQCLVDNGIGSAQSAGRLTVKSEPQLGSPPDILTEAPP
PSIHPIQSDEGDQLFPHEEEEEGLIEGEGLGDPMGQPTERSNDRLTPEAPIITSPPQTHK
PDIYDLEWRAGRDWGHPINAYFVKYRKVDDETGVVGTWQTVRVPGSEKTLRLSELEPSSL
YEVLMVSRSSAGEGQPAMLTFRTGKEKSPPVSKNPSKAPTVSVPAKAPEDKTTNTHFGVV
IHERVPEAPDRPTISMATESSVYVTWIPRANGGSPITAFRVEYRRQGRNAAWVVAADNIS
PLKLSVEVRSLEPGSTYKFRVIAMNQNGDSPHSATSRPYQVSAASPRFSDRPVAGPHISS
TDAVSDTQIMLRWTYTPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGLKQWHLIGQL
QPETSYDIKMQCFNDGGESEYSNVMICETKARQPPGVPSQHPITPPGPFPPDTPTPPGGL
LYLIVGCILGVMVLILFAFIAMCLWRNRQQNAMHKYDGYLYQPAEMNGHVLEYATLPVSG
RIHGAYGHGGRTPGCHHLHHDVPNGSAGLTYTPGGPPHGHDPTPPHGHDPTLPQHSTGEY
KHPVPHRHHHNGGGIYTALPQTDSTDCMSCQNFCNNNRCYTKTNGTFSGGTLPLMQRVAQ
NQDRGAVLGLEMVPLGQVSPHCRGQDGHLLLRDRSTQPGEHGNQDDQEDHEGRDSSLSQT
SCCPQGDHHQHLCPGEVVTDDEPEECVESEGVVVCWESLGLSDLDLKEKPAWISTGSLNM
ALQGDLIQPTPQEV
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgacggcaggtcggagggttctgtcgacagtgctgtgtctaagccacgccctcctcctc
tccagctctgccgttgcgtccctgtcgttcctctccgagcccacgtcggtggttcagatc
cagggcagcgacgttgagctgcggtgttcagcgcagcccaactcctccggcctgtccctg
tcctggcgctttaggggccgacccctggacccggccagtgtgcccggcgtggaactgact
cccagtgggggggtcttgtccctgtaccccctccaggccgtccaccagggactgtaccag
tgtgtggctcagtccgacacaggggccatcatcagccgatacgcacgcgtggctatcgct
gatatagctgagtatggcgagacacaacgacgttcgttggtggttcaggagggtagcagc
gttgtgatccagtgtcctctgccccccagtgcccccccggctgtcccccgggtgagggtg
cgaggggagtggctagagaattccacagacaactacatagttgttccttctgggaacctt
cagatcctgtctgtttccccccgacatggaggcatttataagtgtggcgcatacaaccct
gttaccaaggagaacagggtcgaaggtcatggtaccaagttgactgtgaaacctgcagac
aacccttccccggcaaggatagtttaccccatcgtcccgaccaccgtatcggcggagccg
tccgccacgctggtgttggagtgtgtggtgtcaggcagtccgatgcaccctgccatctgg
ctgaaagacggacgggagctggcagcgccggccaggggccccagggagcacaacaacctg
gttctgttggacctgaggaggagcgactccgggatctaccagtgttctgttcagacggag
aaaggaactctgctcagtgtcaactatactgtgaatgttctggaggaggcgtctgtcctc
agaggtctcaccgaccagtctgtctcttccggagactctgctcgtttcaactgccttgcc
aagggaaaccccacccccggtgtcacctggcttttcaacgcctcccccatcgccccctcg
acccgcctccggatctcaggctccaccctcattatttcaagggtgacattgaaggacgag
ggtgtgtaccaatgcctggtggacaacgggattggctcagcgcagtcagctggcaggctc
acggtcaaatcagaacctcagcttggttccccacctgatattctgactgaggctccaccc
ccctccatccacccaatccagagtgatgagggagatcagctcttcccacatgaggaggaa
gaggaggggctaatagaaggggaggggttgggggatcctatgggccaaccaacagagagg
agtaatgataggctcactcctgaagcaccaatcatcacctctcctccccaaacacacaaa
cctgacatctatgacctggagtggagggcgggacgagactggggacatccaatcaacgca
tacttcgttaaataccgcaaggttgatgatgagaccggggtagtgggtacctggcagaca
gtccgtgttcctggcagtgagaagaccctccgtctgtctgaactggaaccatccagtcta
tatgaggttctgatggtgtcacgcagctctgctggagagggacaaccagccatgctcacc
ttccgaacaggcaaagagaagagcccaccggtcagtaagaatccttccaaggctccgacg
gtgtcggtccccgccaaagctccggaggacaaaaccaccaacacacattttggagtggtc
attcacgaacgggtgcctgaggcccctgataggcccaccatctccatggcgacagagagt
tctgtgtacgtcacatggatcccgcgggccaatggcgggtctcccatcacagcgtttcgt
gtggagtatcgccgccagggccggaatgcagcgtgggtcgttgccgccgacaacatttcc
cctctcaaactgtcggtcgaagtacgaagtctggaacctggctccacctataagtttcgt
gtgattgctatgaaccagaacggggacagtccccacagcgccacctccaggccctaccag
gtgtctgccgccagcccacgcttctcagaccgccctgtggctggaccgcacatctcctct
acggacgctgtctccgacactcagatcatgctgcgctggacctacaccccatccagtaac
aacaacacacccattcaaggattctacatctactacaggcctactgatagtgataatgac
agcgactacaagcgggatgtggtagaaggtctaaaacagtggcatctgattggtcagctg
cagccagagacgtcatatgacataaagatgcagtgttttaatgacggaggggagagtgaa
tacagtaatgtcatgatctgtgagaccaaagcacggcagcccccaggggttcccagccag
caccccatcaccccgccgggccccttccccccagacacccccacaccccccgggggcctg
ctctacctgattgtgggctgtatcctcggggtcatggtcctgatcctcttcgctttcatc
gcaatgtgtctctggaggaaccgtcagcagaacgccatgcacaagtacgacgggtacctc
taccagcctgcggagatgaacggccacgtgttggagtacgccacattgcccgtgtccggg
cgcatccacggggcttatggtcatggcggtcggactccgggctgccaccatctgcaccac
gatgtgccgaacggctcggctggcctgacctacacacccggaggccccccacatggccac
gaccccacccccccacatggccacgaccccaccctgccgcaacacagcaccggggagtac
aaacaccctgtgccccaccggcaccatcacaatggaggaggaatctacacagctttgcct
caaacggattcaacagattgtatgagctgccagaacttctgcaacaacaacagatgttac
acgaagaccaacgggacgttctccgggggcactctacccctaatgcagcgcgtggctcag
aaccaggaccgaggcgcggtcttgggtctcgagatggttcccctgggccaggtgtctcct
cactgccggggccaggacggacacctcctcctcagggacaggagcacacagcctggggag
catgggaaccaggacgaccaagaggaccatgagggaagggactcatctctgtcccagacc
tcctgctgtcctcagggggaccaccatcaacacctgtgccctggagaagttgtcacggat
gatgaacctgaggagtgtgtggagtctgagggagtggtggtgtgttgggagagcctgggt
ctgtctgaccttgacctcaaggagaaaccagcgtggatctccacaggcagcctgaatatg
gccctgcagggagacctgatccagccgacccctcaggaggtctga

KEGG   Esox lucius (northern pike): 105029624
Entry
105029624         CDS       T04894                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105029624
SSDB
Motif
Pfam: GDNF Orthopox_A36R DUF1380
Other DBs
NCBI-GeneID: 105029624
NCBI-ProteinID: XP_010901386
LinkDB
AA seq 373 aa
MYHPQSNGQVGAYQPRTREVPPDQEAVRHQKVQAYQRRSNAPEFNPGNKAWPVVPGALGG
SGPAVVSPHPVEVAGGPAYKVEVILASGPEGQDHFMHSLPSHLTSLLRNGKFCRVYKWTG
RSTLYLCCAFVLFGCLCIGSPTHGRRLICWQAIMKCHGEPECHYAYDQYLYACAPVINGN
RKKCPSHCISSLIQLNLTEAGPSLEDCDCASDTICRKTKRAIEPCLPRTSNMGCTEARRQ
CERDSQCSSSMRDYLFHCRKLFGGERCSDDCRRVISNMRNIPKAQQLDTCVCDGTERTIC
EYVKVSMKNFCFDSVDRYAGSGFSDSEDDSEDDYDEMEYENDVENSSGSSKFACQGVWTA
AMATILVSVHLIC
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtaccacccacagagcaacgggcaggtcggagcgtaccaaccaagaactagggaggta
cctccagaccaggaggcagtgcgacatcagaaggtgcaggcgtaccagcggcggagcaac
gcaccagagtttaatccagggaacaaggcgtggccggtggttcctggtgcgctgggggga
tccggtcccgcagtggtgtctccacatccggtggaggtagctggtggtcctgcgtacaag
gttgaggtgattctggcctctggacctgagggacaggaccattttatgcactcactaccc
tcgcacctcacaagtctgcttcgaaatggcaagttttgccgcgtttataagtggactggg
cgatcaactttgtatttatgctgtgcttttgtcctgttcggttgtctctgcatcggatct
ccaactcatggtcgtcggctcatctgttggcaagccataatgaagtgtcatggagagccg
gagtgccactatgcatatgaccaatatctttacgcttgtgcgcccgttatcaatgggaat
aggaagaaatgtcccagccactgcatctcgtctcttatccagctgaatctaaccgaggcc
ggcccgtctctggaggactgtgactgcgcctcggacaccatctgccggaagaccaaacgc
gccatagagccgtgtcttccacggaccagcaacatgggctgcaccgaagctcggcggcaa
tgcgaaagagactcccaatgtagttcgtctatgcgggactatttgtttcactgccgtaaa
cttttcggaggggagaggtgttcagatgattgccggagggtgatttccaacatgcgcaat
atacccaaagcacaacaacttgatacttgtgtttgtgatggcacagagaggacgatatgc
gaatatgttaaagttagtatgaaaaacttttgctttgactctgtggacagatacgcgggc
agcgggttttctgattcagaggatgactcggaagatgattatgatgagatggaatatgaa
aacgatgtggaaaactcaagtggctcttccaaattcgcctgtcagggtgtatggaccgct
gctatggccaccattttggtttcagtgcatcttatctgttag

KEGG   Esox lucius (northern pike): 114833178
Entry
114833178         CDS       T04894                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114833178
SSDB
Motif
Pfam: GDNF Orthopox_A36R DUF1380
Other DBs
NCBI-GeneID: 114833178
NCBI-ProteinID: XP_028974443
LinkDB
Position
Unknown
AA seq 265 aa
MASFAAFIKWTGRSTLYLCCAFVLFGCLCIGSPTHGRRLICWQAIMKCHGEPECHYAYDQ
YLYACAPVINGNRKKCPSHCISSLIQLNLTEAGPSLEDCDCASDTICRKTKRAIEPCLPR
TSNMGCTEARRQCERDSQCSSSMRDYLFHCRKLFGGERCSDDCRRVISNMRNIPKAQQLD
TCVCDGTERTICEYVKVSMKNFCFDSVDRYAGSGFSDSEDDSEDDYDEMEYENDVENSSG
SSKFACQGVWTAAMATILVSVHLIC
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcaagttttgccgcgtttataaagtggactgggcgatcaactttgtatttatgctgt
gcttttgtcctgttcggttgtctctgcatcggatctccaactcatggtcgtcggctcatc
tgttggcaagccataatgaagtgtcatggagagccggagtgccactatgcatatgaccaa
tatctttacgcttgtgcgcccgttatcaatgggaataggaagaaatgtcccagccactgc
atctcgtctcttatccagctgaatctaaccgaggccggcccgtctctggaggactgtgac
tgcgcctcggacaccatctgccggaagaccaaacgcgccatagagccgtgtcttccacgg
accagcaacatgggctgcaccgaagctcggcggcaatgcgaaagagactcccaatgtagt
tcgtctatgcgggactatttgtttcactgccgtaaacttttcggaggggagaggtgttca
gatgattgccggagggtgatttccaacatgcgcaatatacccaaagcacaacaacttgat
acttgtgtttgtgatggcacagagaggacgatatgcgaatatgttaaagttagtatgaaa
aacttttgctttgactctgtggacagatacgcgggcagcgggttttctgattcagaggat
gactcggaagatgattatgatgagatggaatatgaaaacgatgtggaaaactcaagtggc
tcttccaaattcgcctgtcagggtgtatggaccgctgctatggccaccattttggtttca
gtgcatcttatctgttag

DBGET integrated database retrieval system