KEGG   Esox lucius (northern pike): 105006960Help
Entry
105006960         CDS       T04894                                 

Gene name
tgm1
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105006960 (tgm1)
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     105006960 (tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 105006960
NCBI-ProteinID: XP_010864004
LinkDB All DBs
AA seq 782 aa AA seqDB search
MPVETRSARNQSNVGRFPSVTLGLGEDEPGKEELKEETAEEGACRRWWRKMCPCCCKKRH
YDDDITDTVVTGIDDVEKDTGINCDKPVNVGTELDELLLMVRSIDLVKKKNGQNRLEHHT
DRYHSDDLLIRRGQAFIMWLDLSRPYNPKNDKLHLELRTGPLPTVAKHTHIIIPLVEQME
VNRWEAKISQRDGNRLKLSVNSPSTAVIGRYQLTVVTQSPKGEATSTHDPVNDIRMLFNP
WCEDDTVYMDDECERNEYVLNDVGRLYYGTENQIGSRTWNYGQFDEGVLDACLFILEKSG
VLPSGWGDSVNIVRVISAMINSPDDCGVLEGNWSGNYVGGTSPTAWSGSVDILKKYHKDG
GVPVKYGQCWVFSGITTTVLRCLGIPCRSVTNFNSAHDTDVSLTTDVYFDENLEPIEDLN
NDSIWNFHVWNDCWMARPDLPPGYGGWQAVDSTPQETSQGSFRCGPASIIAVRNGNVFLK
HDAPFVFAEVNSDKIYWQRKPDGTFTQIASETKVVGHCISTKAVGSDERNDITLLYKHPE
GTEEERIAVETASRYGSKPKTYASPKAEDVSIEVTMDGEGPRMGGDAELTIVIRNTSSLL
RTFTLNSQVAVMYYTGVLKATIKKDQTPVELLPNEVKTLEWVLDYQHYKDQLVDQAALML
TLSGRVSETQQVLATQFSFRLRTPDLFIKPIGEAVMGKKMSAEISFTNPLPHKLKNVVFR
VEGLGLQSVRQISVGDVGSHASVTMTEHFIPTLPGPRKLLASLDCKQLTQVHGVVNIDVK
EK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtggaaacacgttcagccaggaaccagtccaatgttggtcggttcccatcagtt
acactgggtttgggcgaggacgagccagggaaagaggagctaaaggaggagactgctgaa
gaaggggcgtgccgacgatggtggcgtaaaatgtgtccttgctgctgtaagaaacggcat
tacgatgatgatatcacagatacagtcgtcacaggaattgacgatgtagaaaaggataca
ggaataaattgtgacaagcccgttaatgttggaactgagcttgacgagctgctgttgatg
gtgcggtccatagacctggttaaaaaaaagaatggtcagaatcgtctggaacatcacact
gaccgttaccacagtgacgacctcctcatccgccggggtcaggccttcataatgtggctt
gacctctcacgaccttacaaccccaagaatgacaaactccacttggagctcagaacagga
cccctgcctacagtagcaaagcacacccatatcatcatcccattggttgagcagatggag
gttaaccgttgggaggccaagatctcacaacgagatggtaacaggctaaagctgtctgtc
aactctccatcgaccgctgtgatcggccgatatcagctcactgtggtgacgcagagccca
aagggcgaggccacatctacacatgaccctgtgaatgacatccgcatgcttttcaacccc
tggtgtgaagatgacacagtgtacatggatgatgagtgtgaaaggaacgagtatgtcctg
aatgatgttgggaggctttactatggcacggaaaaccagattggatcaagaacgtggaat
tatggacagtttgatgagggggtcctggatgcctgtctgttcattttggaaaaaagtggt
gtcttaccctcaggatggggagactctgtcaatatagtccgagtcatttcagccatgatc
aattccccagacgactgtggagtcctggaggggaactggtcagggaactatgtgggcggg
acatccccaacagcctggagtggtagtgtggatatcttgaagaaataccataaagatgga
ggcgttcctgtcaaatatggccagtgttgggtcttctctgggatcaccaccacagttttg
aggtgcttgggcattccctgccgcagtgtgaccaacttcaactcagcccatgacacagat
gtctccttgacgaccgatgtgtactttgatgagaatttggagcctatagaggacctgaac
aacgactccatctggaacttccatgtgtggaatgactgttggatggctcgcccagacttg
ccacctggttatggcggatggcaggctgtggactccacaccccaggagaccagccagggc
agcttccgctgtggccccgcctccatcatcgctgtccgcaatggaaatgtgttcctcaaa
cacgatgcgccctttgtctttgccgaggtgaacagtgataaaatctactggcagaggaaa
ccggatggcactttcacccagatagcgagtgagaccaaggttgtgggacactgcattagc
accaaggctgtgggctctgacgagcgcaacgacatcacactcctttacaagcacccagaa
ggcacagaggaggaacgcatcgctgtggagacggccagccgctatggctccaaacccaag
acatatgcatcgcccaaagcagaggatgtgtccatagaggtgaccatggatggagagggg
ccacgcatgggtggagacgcagagctgaccattgtcattcgcaacacaagttctctactg
cgcactttcaccctcaatagccaggtggcagtcatgtactacacaggcgtgcttaaggct
accatcaagaaggaccaaacccctgtagagctattacccaatgaggtgaagacactggag
tgggttcttgattaccagcactataaggaccagctggtggaccaggctgctttgatgctg
accctgtctggtcgggtcagtgagacccagcaggtcctggccactcagttcagcttccgt
cttcgtacgcctgacctctttattaagccaataggggaggcagtgatggggaaaaagatg
tctgctgagatctccttcaccaacccgttgccacacaagttgaagaatgttgttttccgt
gtggaagggctgggtctacagagtgttcgacagatctctgtcggtgatgtgggcagtcat
gcctctgtgactatgacagaacactttattcccactctgcccggacccaggaaactgttg
gcctcactcgactgtaagcagctgacacaagtccacggtgtggttaacatcgacgtcaag
gagaaatga

DBGET integrated database retrieval system