KEGG   Esox lucius (northern pike): 105007172
Entry
105007172         CDS       T04894                                 

Gene name
sufu
Definition
(RefSeq) suppressor of fused homolog isoform X1
  KO
K06229  suppressor of fused
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105007172 (sufu)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 105007172
NCBI-ProteinID: XP_010864300
UniProt: A0A3P9AIW5
LinkDB
AA seq 471 aa
MDEVRPISGPAAPGLASLFPPGLQAIYGECRRLYPDQANPLQVTAIVKYWLGGPDPLDYI
SMYRNVGCDAQNVQEHWHYVSFGLSDLYGDNRVHEFTGQEGPSGFGFELTFRLKREVGET
APPTWPAELMQGLARYVFQSENTFCSGDHISWHSPLDNSESRIQHMLLTEDPQMTPVHTP
FGLVNFLQIVGVCTEELQAAQQWNGQGILELLRGVHVAGGSWLITDMRRGETIFDIDPHL
QQERVDQGIETEGSNLSGVSAKCVWDDLSRPPEDEEDSRSICIGSQPRRLSEKDTEQIRE
ALRKGLEFNTKAALPPINSQRQGHDRPQSRKDSLESDSSAAIVPHELVRTRQLESVHLKF
NQESGTLLPLCLRGRLLHGRHFTYKSINGDTAITFVSTGVEGAFATEEHPYAAHGPWLQI
LLTGEFVEQMLEDLSELNTREETKLPKEYSWPEKKLKISVLPDSVFDSPLQ
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggacgaggtgaggcctatcagcggaccagcagcccccgggctggcgtcactcttcccc
cctggtctgcaggcaatttacggggaatgtaggcggctgtaccccgaccaggccaacccc
ttgcaagttacagctattgtcaaatactggttaggaggtccagatcctctggactacatc
agcatgtaccgcaatgtggggtgcgacgcacagaacgtacaagaacactggcactacgtc
agctttggactcagcgacttgtatggagacaacagagttcatgagtttacaggtcaggaa
ggccccagtggctttggctttgagctgacgttcagactgaagagagaagtgggagagaca
gcaccccctacctggccagctgaactcatgcagggcctggcccgctacgtcttccagtca
gaaaacacattctgcagtggcgaccacatatcgtggcacagtccactggacaacagcgag
tctcgtatccaacatatgctgctcacagaggacccccagatgactccggtccacacgccc
tttggcctagtcaacttcctgcagattgtgggtgtgtgtacggaagagctgcaggcagcc
cagcagtggaatggtcagggaatactggagctgcttcgaggggtccacgttgccggaggg
tcctggttgattactgatatgaggagaggagagaccatcttcgacatcgatcctcattta
caacaggagcgtgtggatcagggtatagagacagagggctcaaaccttagtggtgtgagt
gccaaatgtgtgtgggacgaccttagccgaccgcctgaggatgaagaggacagccgttct
atctgtataggatctcaaccccgaagactgtcagaaaaagatacagagcagattcgagaa
gctctaaggaaaggattggagttcaacacgaaagcagctttacccccgatcaactcacaa
agacaaggacatgacagacctcagagtcgtaaagatagcctggagagtgacagttctgca
gccatagtccctcacgagctggttcgtactagacaactggagagtgttcatctgaaattt
aaccaggagtccggaacactgcttcccctctgtctcaggggtcgtttgcttcatggccga
cacttcacttataagagtataaatggtgacaccgctatcacctttgtatccaccggagta
gaaggggcctttgcaactgaggaacacccatacgctgcacatggaccctggctacagata
ttgctgactggggagtttgttgaacagatgcttgaagatctgtcagagctcaatacccga
gaagagacaaagttaccaaaggagtacagctggccggagaaaaaactgaagatatcggtc
ctgcctgactctgtgtttgacagcccactgcaatga

DBGET integrated database retrieval system