KEGG   Esox lucius (northern pike): 105007693Help
Entry
105007693         CDS       T04894                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3 isoform X1
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105007693
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    105007693
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105007693
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     105007693
Protein kinases [BR:els01001]
 Serine/threonine kinases: STE group
  STE11 family
   105007693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 105007693
NCBI-ProteinID: XP_028972039
LinkDB All DBs
AA seq 595 aa AA seqDB search
MMTVNMDNGFQNGPGQPRNSQDDEEALSSIMKDLAALGRCYSQQHKSHKPQAQLFKQDLR
VKLEHDREKRIIPFQRPLRIKELLQKVTEAFGQQMDVFFPDREQLVPLKTQDDLDRAVLS
VSSASLLRLLLKTHKNSQFLQVGSRDKQSEMRSSRSLGDLKGSLLKGSDRVRKHSTGSLH
SGRRSPPPGSVPEEQQLIARQGSYTSIHSEGEFIPEGLDQSLLEPFGSADTSLSSSCQSI
DQALDSPPFSQNNRDNNYLNLNYEGYKGRHSKGGTFPRQFHLSNRSKDYSDGRRTFPRSF
MPQENVFQLVPSSRTRSYNGAPNSPRAPVNWRQGKLLGRGAFGEVYLCYDADTGRELAAK
QVPFDPDCQETSKEVNALECEIQLLKNLHHERIVQYYGSTRDLEQRKLTIFVEFMPGGSI
KDQLKSYGALTEKVTRRYTRQILQGVFYLHSNMIVHRDIKGANILRDSSGNVKLGDFGAS
KRIQTICMSGTGIKSVTGTPYWMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYE
AMAAIFKIATQPTKPLLPESVSDAARDFIRQVFVAEELRPTAESLLSHPFVQGGF
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagtaaacatggataacggtttccaaaatggacctggacagcctaggaactca
caagatgacgaagaggctctgagctccatcatgaaggacctggctgcccttggtcgttgt
tactcacagcaacacaaaagccacaagccgcaggcccagctgtttaaacaggatctaaga
gtcaagctggagcacgatagagagaaacgcatcatcccgttccagcgacccctgagaatc
aaagagctcctccagaaggtgactgaggcctttggacaacagatggatgtgttttttcca
gacagagagcagctggtccctctgaagacccaggatgatctggaccgagctgtcctcagc
gtgagctcagccagcctactcagactgctgctgaaaacacacaaaaacagccagtttcta
caggtgggcagcagggacaaacagagtgagatgaggtcatcccgttctctaggtgacctg
aagggttccctactcaagggctcagatagggtccgcaaacactcaacaggttccctccat
agcggccgtaggtccccccctccaggatcggtgcctgaggagcagcaactgatcgccagg
cagggctcctacacctccatccactctgagggagagttcatccctgagggactggaccag
agtctgctggagccatttggtagtgcagacacctctctgtccagcagctgtcagtcaata
gaccaggcattagacagccctcctttctcccaaaacaaccgagacaacaactacctgaac
ctcaactatgaaggatataaaggtcgccatagtaaaggagggactttccctcgtcagttt
cacttgtccaatcgtagcaaagattacagcgacggtcggaggacgttccctcggagcttc
atgccccaggagaacgtattccagctggttccatccagtcgtacacgaagctacaatggc
gccccgaactctccacgggcaccggtcaactggcgccaagggaagttgttggggcgcggg
gcatttggggaggtatatctctgctacgacgcagatactggacgggagttggcagccaaa
caggtgccctttgaccctgactgtcaggagaccagcaaggaggtgaacgctctggagtgt
gagatccagttgttaaagaatctgcatcatgagcgtattgtccagtactatggatccact
agagacctagaacaaaggaaactcaccatctttgtggagttcatgcctgggggctcaatt
aaggaccagctgaagtcctacggagcactgacagagaaggtgacccgacgctacaccaga
cagatcctccagggggtgttctacctacacagcaacatgatcgtacacagggacatcaaa
ggggccaacattctgagggacagttcaggcaacgtgaagctgggagactttggggccagt
aaacggatccagaccatctgcatgtcagggactgggatcaaatccgtgaccggtaccccc
tactggatgagcccggaggtcattaacggagagggatacggacgcaaagcggatgtctgg
tctgtggcatgcacagtggtggagatgcttacccagaagcctccctgggcggaatacgag
gcaatggcggccatctttaagatcgccacgcaacccacgaagcccctcctccctgagagc
gtgtcagacgcagcccgggacttcattcgccaggtgttcgtagcagaggagttgcgtcct
acagctgagagtctcctctctcacccctttgttcaggggggtttctga

DBGET integrated database retrieval system