KEGG   Esox lucius (northern pike): 105007706Help
Entry
105007706         CDS       T04894                                 

Gene name
tufm
Definition
(RefSeq) elongation factor Tu, mitochondrial isoform X2
  KO
K02358  elongation factor Tu
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:els03012]
    105007706 (tufm)
   03029 Mitochondrial biogenesis [BR:els03029]
    105007706 (tufm)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105007706 (tufm)
Translation factors [BR:els03012]
 Eukaryotic Type
  Elongation factors
   105007706 (tufm)
 Prokaryotic Type
   105007706 (tufm)
Mitochondrial biogenesis [BR:els03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    105007706 (tufm)
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   105007706 (tufm)
  Exosomal proteins of breast cancer cells
   105007706 (tufm)
  Exosomal proteins of colorectal cancer cells
   105007706 (tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 105007706
NCBI-ProteinID: XP_010865019
LinkDB All DBs
AA seq 461 aa AA seqDB search
MTSLPSSCLTLYKMAALVGIRACFSALQLSSPGLLHTSYKVCAVPFTRRNFAAEAKVKKT
YARDKPHVNIGTIGHVDHGKTTLTAAITKVLAEAGGANYKKYEDIDNAPEEKARGITINA
SHVEYATANRHYAHTDCPGHADYVKNMITGTAQLDGCILVVAATDGQMPQTREHLLLARQ
IGVENVVVFVNKADAVEDKEMLELVELEIRELLTEFGYDGENTPVVIGSALCALENRQPE
LGANAVLKLLQVVDEYVPLPKRELDKPFLLPIEGVYSIPGRGTVVTGTLERGVIKKGDDC
EFVGHSRAFKSVVTGIEMFHQSLDRAEAGDNLGALVRGLKREDIRRGMVMSKPGSIQPHQ
KVQAQVYILSKEEGGRHKPFVSNFMPVMFSLTWDMACMVTLPQDKEMVMPGEDTSLTLTL
RQPMVLEKGQRFTLRDGNKTIGTGLVTEILTATEDDGCNWG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacttccatctagttgtctaacattgtacaagatggcggcgctcgtagggatt
cgtgcatgtttctctgctcttcagctttcctcgccgggtcttctgcacacctcctataaa
gtgtgtgcagtgccatttactcggcggaactttgcagcagaggccaaggttaagaaaaca
tacgcgagagacaaaccccatgttaacatcggcacgattggacatgtcgaccatggcaag
accactctcacagctgccatcaccaaagtgctggcggaggctggaggcgccaactataag
aagtatgaggacattgacaatgctcctgaagagaaggccaggggtatcaccatcaatgcg
tcccatgtagagtatgccacagccaacagacactacgcgcacacagactgtcctggccat
gctgactatgtcaagaacatgatcacgggcacggctcagcttgatggctgcatcctggtg
gtggccgccacggacggccagatgccccagaccagggagcacctcctgctggcgcggcag
atcggcgtggagaacgttgtggtgtttgtgaacaaggcggatgctgtggaggacaaggag
atgctggagctcgtggagctggagatccgtgagctgctcaccgagttcggctacgatggc
gagaacacgcccgtggtcatcggctcggctctctgcgccctggagaacagacagccagag
ctgggagcaaacgctgtgttgaagcttctgcaggttgtggatgaatatgttccgctgccc
aaaagagaactcgataaacccttcctgctgcctatcgagggtgtctattccatcccaggc
aggggtacagtggtgactggcactttggagaggggtgtcatcaagaagggtgacgattgt
gagtttgtgggtcacagccgcgctttcaagtcggtggtcactggcatcgagatgttccat
cagtctctggaccgggccgaggccggggataacctgggggctctggtccgagggctgaag
agggaggacatcaggcgagggatggtgatgagcaaaccaggctccattcagccccaccag
aaagtccaggcccaggtttatattctgagtaaggaggagggaggaagacacaagcccttt
gtcagcaacttcatgcctgtcatgttctctctcacctgggacatggcctgcatggtcacc
ctgccccaagacaaggaaatggtgatgccaggtgaggatacttctctgaccctgacgctg
cgccagcctatggttctggagaaaggtcaacgctttactctccgagacggaaacaaaact
attggcaccggcctggttactgaaatacttaccgcaacagaagacgacggttgcaattgg
ggctga

DBGET integrated database retrieval system