KEGG   Esox lucius (northern pike): 105007707Help
Entry
105007707         CDS       T04894                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
els  Esox lucius (northern pike)
Pathway
els00500  Starch and sucrose metabolism
els01100  Metabolic pathways
els04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105007707
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    105007707
Enzymes [BR:els01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     105007707
Glycosyltransferases [BR:els01003]
 Polysaccharide
  Storage polysaccharide
   105007707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 105007707
NCBI-ProteinID: XP_010865023
LinkDB All DBs
AA seq 714 aa AA seqDB search
MPLARSMSITSLSGMEEWDEEFDLEDAVLFEIAWEVANKVGGIYTVIQTKARLTVEEWGE
NYFLVGPYVESNVRTQVELIEPTNPALKRTIDKMNSSGCKVYFGRWLIEGSPYVVLIDVA
FTAWSLDKWKTELWNNFSIGVPWFDREANDAVLFGFLTAWLLGEFAAQCEEPPHILAHFH
EWLAGLGLALCRQRLLPVATIFTTHATLLGRYLCAGSVDFYNNLANFNVDKEAGDRQIYH
RYCLERTAARCAHVFTTVSQITAVEAEHLLKRKPDIITPNGLNVKKFSAMHEFQNLHAQS
KNRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDV
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTAHTVKERFGKKLYESLLIGQLPDVSKML
DKEDFTMMKRAIFATQRQCQPPICTHNMLEDSTDPILTCIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRYRGVDESCNQLTSYLFQFCQQSRRARIIQRNRTERLSDLLDWRY
LGRYYISARHMALAKAFPDTFFYQPHDSETAQGFRYPRPASVPPSPALSRHSSPHHSEAE
DEDDRYDEDEEAEKDRLNIRQPLALPTKKGPLPYPLPATAANGNGDRAIKSEKN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggctcggagcatgtccatcacgtccctgtcggggatggaggagtgggatgaa
gagtttgacctggaggatgccgtcctctttgagatcgcatgggaggtggccaacaaagtt
ggtgggatttacacagtgatccagaccaaggcccgtcttacagtggaagaatggggcgag
aactacttcttggtcggcccgtatgtagagagcaatgtccgcacccaggtggagctgatc
gagcccaccaaccctgccctcaagaggaccatagacaagatgaattccagcggctgtaag
gtttacttcggccgttggctgattgaaggcagcccgtatgtggtgctgattgatgtggcg
ttcaccgcctggagcctggacaagtggaagacggagctttggaacaacttctccatcggg
gtgccgtggtttgaccgagaggccaacgacgccgtcctcttcggtttcctcaccgcctgg
ctactgggagagtttgcggcgcagtgtgaggagcctcctcatattctggcccacttccac
gagtggctggcaggcctgggcttggcgctgtgccgtcagagactgttgcccgtggcaacc
atcttcaccacccatgccacgttgctcggacgatacctgtgtgccggcagtgtggacttc
tacaacaacctggccaatttcaacgtagacaaggaggcgggagacagacagatctaccat
cggtattgtttggaacggacggcggcgcgctgcgctcatgtcttcaccactgtctcccag
atcacagcggttgaggccgagcacctactcaagaggaaaccagacatcataacccctaac
gggctgaacgtgaagaagttctcagccatgcacgagtttcagaacctgcacgctcagagc
aagaaccgtatccaggagtttgtccgaggccacttttacgggcacctggactttaacctg
gacaaatgtctgttcttgtttatcgccgggaggtacgagttcagcaacaaaggggccgat
atcttcctggaggctttggcccgacttaactatcttctgagagtcaaccacagcgatgtg
acggtcgtggctttcttcatcatgcctgcccgcacaaacaacttcaacgtggagactttg
aaaggccaagcagtccggaagcagctctgggatacagcgcacactgtgaaagaacgcttc
gggaagaaactgtacgaatcactgctgattggccagttgccggatgtgtccaagatgctg
gacaaggaggacttcaccatgatgaagcgtgccatcttcgccacccagaggcagtgccag
ccacccatctgcacccacaacatgctggaggacagcaccgaccccatcctcacctgcatc
cgccgcatcggcctgttcaacagctccgccgaccgcgtcaaggtgatcttccacccagag
ttcctgtcttccacctctcccctcctgcccatggactatgaggagtttgtacgaggctgc
catcttggagtgttcccctcttactacgagccctgggggtacacaccagcggagtgcact
gtcatgggaatcccctccatctccactaacctctcaggtttcgggtgcttcatggaggaa
cacatagctgacccctcggcatacgggatatacatcctggacaggcggtaccggggcgtg
gatgagtcctgtaaccagctcacgtcgtacctgttccagttttgccagcagagcaggcgt
gcccggatcatccagcggaaccgcaccgagcgcctgagtgacctcttggactggagatat
ctgggcaggtattacatatctgctcgccacatggccctggctaaggccttcccggatacc
ttcttctaccagccgcatgattctgaaaccgcccaaggcttccgttaccctagaccggcg
tcagtgcccccgtccccggcgctgtcacgccactcctccccgcaccacagcgaggcggaa
gacgaagacgaccgttacgacgaagacgaagaggcggagaaagaccgcctgaatatccgt
cagcctttagccctgcctaccaaaaagggcccattgccttacccccttccagccaccgct
gccaatggaaacggtgatagagccataaaaagcgagaaaaactga

DBGET integrated database retrieval system