KEGG   Esox lucius (northern pike): 105008738
Entry
105008738         CDS       T04894                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04020  Calcium signaling pathway
els04114  Oocyte meiosis
els04140  Autophagy - animal
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04530  Tight junction
els04540  Gap junction
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105008738
   04310 Wnt signaling pathway
    105008738
   04340 Hedgehog signaling pathway
    105008738
   04371 Apelin signaling pathway
    105008738
   04020 Calcium signaling pathway
    105008738
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105008738
  09143 Cell growth and death
   04114 Oocyte meiosis
    105008738
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105008738
   04540 Gap junction
    105008738
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105008738
   04912 GnRH signaling pathway
    105008738
   04914 Progesterone-mediated oocyte maturation
    105008738
   04916 Melanogenesis
    105008738
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105008738
   04270 Vascular smooth muscle contraction
    105008738
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105008738
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:els03019]
    105008738
   03036 Chromosome and associated proteins [BR:els03036]
    105008738
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105008738
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  PKA family
   105008738
Messenger RNA biogenesis [BR:els03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     105008738
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105008738
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 105008738
NCBI-ProteinID: XP_028977286
LinkDB
AA seq 386 aa
MAQGKDHSFLKLDDLASRFFNKYRKSNQELKVQESEVPHISEFTIIWDKMMKEFFAKAKE
DFLQKWESPPQSTTGLDEFDRLKTLGTGSFGRVMLVKHSGREQFYAMKILDKQKVVKLKQ
IEHTLNEKRILQAVCFPFLVRLEYSFKDNSNLYMVMQYVPGGEMFSHLRRNGRFSEPHAR
FYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHRGYIQVTDFGFAKRVKGRTWTLCGTPEY
LAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSLFGND
LKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPFIPKCRGPGDT
SNFDDYEEEEICVSDTEKCVKEFFEF
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggctcagggaaaggatcattcgttcctaaagctggatgacctagctagtcgattcttc
aacaagtatcgcaaaagcaatcaagagctaaaagtccaggagagtgaggtgcctcatatc
tctgagttcaccatcatttgggataagatgatgaaagagttctttgcaaaagcaaaagaa
gattttttacaaaagtgggagagtccaccacagagcacaactggcctggatgagtttgac
aggctgaagactctgggcactggctctttcggtagagttatgttggtgaaacatagtgga
agagaacagttctacgccatgaagattctggacaaacagaaggtggtgaagctgaagcag
atagaacacactctaaatgaaaagagaatactgcaggcggtgtgctttccttttctcgtc
agactggaatattccttcaaggacaactcaaatctctatatggtgatgcagtatgttcca
ggaggagaaatgttctcgcatctgaggcgcaacgggaggttcagtgaacctcatgcacga
ttttatgcagctcagatagtactcacttttgagtacctccactcactagacctcatctac
agagacctgaagcctgaaaaccttctcattgatcatcgagggtacattcaggttacagac
tttggttttgccaaaagagtaaaaggcaggacctggacattgtgtggaactccagagtac
ctggctccagagattatccttagcaagggctacaacaaagctgtcgactggtgggcactg
ggagtactgatctatgagatggccgctgggtaccctccattctttgccgatcagccaatc
cagatctatgagaagattgtgtctggcaaggtacgattcccctccctcttcggcaacgac
ttgaaagacctgcttaggaacctgctccaggtggacctaacaaagcgttatggcaacctg
aagaatggagtgaatgacatcaagaatcacaagtggtttgccacaacggactggatcgct
atctatgagaggaaagtggaagctcccttcataccaaagtgcagaggaccaggagacaca
agcaactttgacgattacgaagaggaggaaatctgtgtgtctgatacagaaaaatgtgtt
aaagagttttttgaattctaa

KEGG   Esox lucius (northern pike): 105013090
Entry
105013090         CDS       T04894                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04020  Calcium signaling pathway
els04114  Oocyte meiosis
els04140  Autophagy - animal
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04530  Tight junction
els04540  Gap junction
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105013090
   04310 Wnt signaling pathway
    105013090
   04340 Hedgehog signaling pathway
    105013090
   04371 Apelin signaling pathway
    105013090
   04020 Calcium signaling pathway
    105013090
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105013090
  09143 Cell growth and death
   04114 Oocyte meiosis
    105013090
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105013090
   04540 Gap junction
    105013090
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105013090
   04912 GnRH signaling pathway
    105013090
   04914 Progesterone-mediated oocyte maturation
    105013090
   04916 Melanogenesis
    105013090
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105013090
   04270 Vascular smooth muscle contraction
    105013090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105013090
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:els03019]
    105013090
   03036 Chromosome and associated proteins [BR:els03036]
    105013090
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105013090
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  PKA family
   105013090
Messenger RNA biogenesis [BR:els03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     105013090
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105013090
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 105013090
NCBI-ProteinID: XP_010872681
UniProt: A0A3P9ALH0
LinkDB
AA seq 379 aa
MSSSDSHRKSSRRHGSRKRESGSGSGTADAPAAAPELSVVIPDVKEFLAKAKEDFLKKWE
NPAQNTAALDGFDRLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQKVVKLKQIEHTLNE
KRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIV
LTFEYLHSLDLIYRDLKPENLLIDNQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIIL
SKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRN
LLQVDLTKRFGNLRNGVNDIKGHRWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDDYE
EEEIRVSFTEKCGKEFAEF
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtcaagctctgacagccacaggaagagctccaggaggcatggtagcaggaagcgggag
tcagggtccggctccgggactgcagacgcgccggctgcagcaccggagctgtccgtggtc
atccctgacgtgaaggagtttctcgccaaagccaaagaagatttcctcaagaaatgggag
aatccagcacagaacacggcagccctggacggctttgaccgtctgaagacactgggcaca
ggctcttttggtcgagtcatgctggtcaagcacaaagagtcgggccagcattttgccatg
aagattcttgacaaacagaaggtggtgaagctgaagcagatagaacacacactgaatgag
aaacgcatcttgcaggccgtcagctttcccttcctggtgaggttggagcactctttcaag
gacaacaccaacctgtacatggtgatggaatatgtccctggtggagagatgttctcacat
ttaaggagaattggcaggttcagtgagccccacgcccgtttctatgccgcccagattgta
ctgacctttgaataccttcactcacttgacctcatctaccgagacctgaagcctgagaac
ctgctcatcgacaaccagggatacatacaggtaacagattttggctttgcgaagcgagtg
aagggccggacctggacgctgtgtggcactccggagtacctggcccctgaaatcatcctt
agcaaaggttacaataaggcagtggactggtgggccctgggtgtgctgatttatgagatg
gctgctggctatcctcccttctttgcagaccagcccattcagatctatgagaagattgta
tcagggaaggtgcgcttcccctcccacttcagctccgacctaaaggatctgctgaggaac
ttgctgcaggtggacctgaccaagcgctttggcaacctacggaatggagtcaatgacatc
aagggccacaggtggtttgccaccaccgactggattgccatttaccagagaaaggtggag
gcaccatttattcccaagtgcaaaggccctggtgacaccagcaactttgacgactacgaa
gaagaggaaatccgagtctccttcacagagaaatgtggcaaggagtttgcagagttctag

KEGG   Esox lucius (northern pike): 105019307
Entry
105019307         CDS       T04894                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04020  Calcium signaling pathway
els04114  Oocyte meiosis
els04140  Autophagy - animal
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04530  Tight junction
els04540  Gap junction
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105019307
   04310 Wnt signaling pathway
    105019307
   04340 Hedgehog signaling pathway
    105019307
   04371 Apelin signaling pathway
    105019307
   04020 Calcium signaling pathway
    105019307
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105019307
  09143 Cell growth and death
   04114 Oocyte meiosis
    105019307
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105019307
   04540 Gap junction
    105019307
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105019307
   04912 GnRH signaling pathway
    105019307
   04914 Progesterone-mediated oocyte maturation
    105019307
   04916 Melanogenesis
    105019307
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105019307
   04270 Vascular smooth muscle contraction
    105019307
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105019307
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:els03019]
    105019307
   03036 Chromosome and associated proteins [BR:els03036]
    105019307
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105019307
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  PKA family
   105019307
Messenger RNA biogenesis [BR:els03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     105019307
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105019307
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 105019307
NCBI-ProteinID: XP_010883685
LinkDB
AA seq 354 aa
MGNAATAKKGNELESETFVKEFLAKAKEDFLRKWECPPQSMTGLDDFDRLKTLGTGSFGR
VMLVKHKGTEQFFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLEYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQ
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKW
FATTDWIAIYERKVEAPFIPKCRGAGDTSNFDDYEEEEIRVSVTEKCAKEFSEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaaacgctgctaccgccaagaaaggcaacgagctggagagcgagacttttgtaaaa
gagttcctagctaaagccaaagaagacttcttacggaaatgggaatgtccaccgcagagc
atgacgggcctagatgactttgacaggctaaagaccctgggtacaggctcattcggaaga
gtcatgctcgtcaaacataaaggaacagagcagttctttgccatgaaaatactggacaag
caaaaggtggtgaaactcaagcaaatagaacacacgctaaacgagaagagaatattgcag
gctgtctcttttcccttccttgtccgacttgagtatgccttcaaggacaactccaatttg
tacatggtgatggagtatgttccaggaggagagatgttctcacatctaagacgaatcgga
agattcagtgaaccgcatgcacggttttacgcagcccagatagtactgacgtttgagtac
ctccattcattagaccttatctacagagatttgaagcctgagaaccttctcatcgaccag
cacggctatatccaggtaacagactttgggtttgccaagcgggtaaaaggcagaacatgg
acgttgtgtggaactccagagtacctggcgcctgagatcatcctcagcaagggctataac
aaagcagtggactggtgggccctgggggtccttatatatgagatggctgcaggataccct
cccttctttgctgaccagcccattcagatctatgagaagattgtttctggaaaggtccgt
tttccatcccacttcagctctgacctgaaggacctgctgaggaacctcctgcaggtggac
ttgaccaaacgctacggcaacctaaagaatggcgtcaacgatattaagggtcacaagtgg
tttgccacaacggactggatcgctatctacgagaggaaggtggaggccccgttcatacca
aagtgtcgaggcgcaggagacacgagcaactttgacgactatgaggaggaggagattcgc
gtctccgtaacggaaaaatgcgcaaaggagttttccgagttttag

KEGG   Esox lucius (northern pike): 105029732
Entry
105029732         CDS       T04894                                 

Gene name
prkaca
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04020  Calcium signaling pathway
els04114  Oocyte meiosis
els04140  Autophagy - animal
els04261  Adrenergic signaling in cardiomyocytes
els04270  Vascular smooth muscle contraction
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04530  Tight junction
els04540  Gap junction
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105029732 (prkaca)
   04310 Wnt signaling pathway
    105029732 (prkaca)
   04340 Hedgehog signaling pathway
    105029732 (prkaca)
   04371 Apelin signaling pathway
    105029732 (prkaca)
   04020 Calcium signaling pathway
    105029732 (prkaca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105029732 (prkaca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    105029732 (prkaca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    105029732 (prkaca)
   04540 Gap junction
    105029732 (prkaca)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    105029732 (prkaca)
   04912 GnRH signaling pathway
    105029732 (prkaca)
   04914 Progesterone-mediated oocyte maturation
    105029732 (prkaca)
   04916 Melanogenesis
    105029732 (prkaca)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105029732 (prkaca)
   04270 Vascular smooth muscle contraction
    105029732 (prkaca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105029732 (prkaca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:els03019]
    105029732 (prkaca)
   03036 Chromosome and associated proteins [BR:els03036]
    105029732 (prkaca)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     105029732 (prkaca)
Protein kinases [BR:els01001]
 Serine/threonine kinases: AGC group
  PKA family
   105029732 (prkaca)
Messenger RNA biogenesis [BR:els03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     105029732 (prkaca)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105029732 (prkaca)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pkinase_C
Other DBs
NCBI-GeneID: 105029732
NCBI-ProteinID: XP_028978219
LinkDB
AA seq 351 aa
MGNVPTAKKGSEMESVKEFLAKAKEDFLKKWENPAQNTASLDQFERLKTLGTGSFGRVML
VKHKETGQHFAMKILNKQKVVKLKQIEHTLNEKRILTAVSFPFLVQVEYSFKDNTNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFAT
TDWIAVYQRKVEAPFVPKFKGPGDTSNFDEYEEEEIRVSISEKCAKEFAEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgtgcccacggccaagaaggggagcgagatggagagtgtgaaggaattcctc
gctaaagcaaaagaggactttctcaagaagtgggagaaccctgcacagaacacagccagt
ctggaccagtttgagcggttgaaaactctgggtacgggttcttttggccgcgtcatgctg
gtcaagcacaaagagaccgggcagcactttgccatgaagatcctcaacaagcagaaggtg
gtcaagctgaaacagatagaacacactctgaatgagaagcgtattctaacagctgttagc
ttccctttcctggtacaagtagagtactccttcaaggacaacactaacctatacatggtg
atggagtatgttcctggtggagaaatgttctcccatctacgacgaattggcaggttcagt
gagcctcatgctcggttctacgcggctcagatcgtcctgaccttcgagtacctgcatgcc
ctggacctcatctacagagacctgaaacctgaaaacctgctcatcgaccagcaaggctac
atacaggtgaccgattttggtttcgccaagcgcgtgaagggccggacctggactctgtgt
ggaaccccggagtacctggcgccggagatcatcctgagcaagggctataacaaagcggta
gactggtgggcgttgggggtgttgatctacgagatggcggccggttatcctcccttcttt
gcagaccagcccatccagatctacgagaagatcgtctccgggaaggttagattcccgtcc
cacttcagctctgatctgaaggatctgctgaggaacctgctgcaggtggacctgaccaag
cgctatggcaacctgaagaatggcgtcaacgacattaagggacacaagtggttcgccacc
actgattggatcgccgtctaccagagaaaagtggaggccccctttgtccctaagttcaaa
ggcccaggggataccagcaactttgacgaatatgaagaagaagagatccgagtctccatc
agcgagaagtgtgccaaggagtttgctgagttctag

DBGET integrated database retrieval system