KEGG   Esox lucius (northern pike): 105008993
Entry
105008993         CDS       T04894                                 

Definition
(RefSeq) casein kinase I-like isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105008993
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105008993
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105008993
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 105008993
NCBI-ProteinID: XP_028974900
LinkDB
AA seq 454 aa
MDFDKRGGGGGGGRTEAEEGKRMSKTGGSRSGHGSRSSGGNSGVLMVGPNFRVGKKIGCG
NFGELRLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSSEGVPQVFYFGPCGKYN
AMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTRSLIYRDVKPENFLVGR
PGSKRQHTIHIIDFGLAKEYIDSETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDL
EALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVR
RLDFFEKPDYDYLRKLFTDLFDRNGYVFDYEYDWVGKPLPTPIGPVPSETPLQPSSRDKA
AQQTKNQSPEPKGSESQPTPVTNRELLGSHLTADRLGGSVQVMSSTNGELNTDDPTAGHS
NAPITAPAEVEVADDTKCCCFFKRRKRKGIQRHK
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggactttgacaagagaggcggagggggaggagggggaaggacggaggccgaggaaggg
aaaaggatgtcgaagaccggtgggagccggtcagggcatggcagtcgtagctcagggggt
aactctggggtgctcatggtgggccccaactttagggttgggaagaagattggatgtggg
aacttcggagaactccgcctcggaaagaacctgtacactaatgaatacgtggccatcaaa
ctggagccaatcaagtccagggcgccacagcttcacctggagtacagattttataaacag
ctggggagttcagagggtgtgccccaggtgttttattttggtccctgtgggaagtacaat
gccatggttctggagctactggggcccagtctagaagacctgtttgatctgtgtgataga
accttctccctgaagactgtcctcatgatcgccatacagttgatcacacggatggagttt
gtccacaccagaagtctgatctaccgggatgtgaagccagagaacttcctggttggtcgt
cccggcagcaaacggcagcataccatacacatcatcgactttggccttgccaaagagtac
atcgactcagagaccaaaaaacacatcccctaccgagagcacaagagcctaactggcact
gcacgctacatgagcatcaacactcacctgggaaaagaacagagcaggagagatgatctg
gaggctttgggtcacatgttcatgtacttcctccgtggcagtctgccctggcagggcctg
aaggcagacacattgaaggagcgctatcagaagattggtgacaccaagcgagccacgccc
atcgaggtgctctgtgagagtttcccagaagagatggccacctacctacgttatgttcgc
cggctggacttctttgagaagcctgactacgattacttgaggaaactcttcaccgacctc
ttcgacaggaacggctatgtctttgactacgagtacgactgggtcggcaaaccactgcct
actcctattggtccagtacccagcgaaacaccccttcagcccagcagccgagacaaggca
gcgcagcagaccaaaaaccagtcgccagaacccaaaggaagtgagtcccagcccactcca
gtgaccaatagagagctcctggggtcccatctaacagctgataggctggggggctctgtc
caggtgatgagttcaaccaatggggagttgaataccgacgacccgactgcgggccattcc
aatgcccccatcactgctccagctgaggtggaggttgctgatgacaccaaatgctgctgt
ttctttaagaggaggaagaggaaaggcatccagagacacaagtaa

KEGG   Esox lucius (northern pike): 105011643
Entry
105011643         CDS       T04894                                 

Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105011643
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105011643
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105011643
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 105011643
NCBI-ProteinID: XP_010870143
UniProt: A0A3P9A310
LinkDB
AA seq 450 aa
MDFDKKAGKGETEEGKKMSKAAGSRTGHMARGAGTNSGVLMVGPNFRVGKKIGCGNFGEL
RLGKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSSEGIPQVYYFGPCGKYNAMVLE
LLGPSLEDLFDLCDRTFSLKTVLMIAIQLITRMEFVHTKSLIYRDVKPENFLVGRPGSKR
QHTIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGH
MFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCESFPEEMATYLRYVRRLDFF
EKPDYDYLRKLFTDLFDRNGYVFDYEYDWVGKPLPTPIGPIPSDTPAQPSRDKAQQQTKN
QSPEPNGDESLRQPSPLTNKETLGSHLTAERLGGSVKVMSSTNGELNTDDPTAGHSNAPI
TAPTEVEVTDDTKCCCFFKRRKRKALQRHK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggattttgacaagaaggcgggtaagggagagacagaggaagggaaaaagatgtctaag
gcagctggcagcaggactggacatatggcccggggtgcagggaccaactctggggttctg
atggttggcccaaacttccgtgttggaaaaaagattggctgtggcaattttggagagctg
cggctggggaagaacctctacaccaacgaatatgtggccatcaaattggaaccaataaag
tcccgggcgccacagcttcatttggaatatagattttataaacagttgggaagttcagag
ggtattcctcaggtgtactactttgggccatgtggaaaatacaacgccatggtgctggag
ttgctggggcccagcctggaagacctgtttgacctctgtgaccgtaccttctctctcaag
accgtcctcatgatagccatacagctgattacacggatggagtttgtccacacaaagagc
ttgatatacagggatgtcaagccggagaactttttggtggggcggccgggcagcaagagg
cagcacacaatccacatcattgacttcgggctggccaaagaatacatcgacccagagacc
aaaaaacacatcccgtaccgggagcacaagagcctgacgggcactgcacgatacatgagc
atcaacacacacttggggaaagaacaaagcaggcgggatgacctggaggctctgggtcac
atgtttatgtacttccttcgaggcagccttccctggcagggcctgaaggcagatacgttg
aaggagaggtatcagaagattggcgatactaagcgagctacgcccattgaagtgctttgt
gaaagtttccccgaagagatggccacctacctgcgctacgtgaggaggctggacttcttt
gagaaaccagattacgactacttacggaaactcttcactgacctctttgacaggaacggc
tatgtctttgattatgaatacgactgggttggcaagccacttcctacaccaataggccct
atccccagtgacacacctgctcagcccagcagagacaaagcacaacagcagaccaaaaac
cagtcgcctgagcccaatggagatgagtctctgcgtcagcccagtccattgaccaataag
gagacactggggtcgcatctcactgccgaaaggcttgggggctctgtcaaggtgatgagc
tcaacaaatggagagctgaacactgatgacccgacggcaggacactccaacgctcccatc
actgctcccaccgaggtggaggtgactgatgataccaagtgctgttgtttttttaaaaga
cggaagaggaaagccctccagcggcacaagtaa

KEGG   Esox lucius (northern pike): 105013760
Entry
105013760         CDS       T04894                                 

Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105013760
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105013760
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105013760
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 105013760
NCBI-ProteinID: XP_010873831
UniProt: A0A3P8Z2R5
LinkDB
AA seq 464 aa
MDHPKDGERPARSSKVVQGRSGHPRPSSSSASSGVLMVGPNFRVGKKIGCGNFGELKLGK
NLYTNEYVAIKLEPVKSRAPQLHLEYRFYKTLGSTAEGLPQVFYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGRQGCKKDHI
IHIIDFGLAKEYIEPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRNTPVEVLCESFPEEMATYLRYVRRLDFFEKP
DYEYLRTLFTELFERKGYTFDYTYDWVGRQIPTPVGSVNVDSGASAITRESHPHRDRPAQ
HQPMRNQTAASDRRGAWEVQPSRTNSSYMASHLASDRHGGSVQVVSSTNGELNVDDPLAA
HSNAPITAQAEVEVVDEANCVKMLNLWCCCFFKRKRKKNTPRQK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggaccatccgaaagatggcgagcggccggcgcggagtagcaaggtggtccaggggcgc
agcgggcaccccagaccctccagctcctccgcgtcctccggagtgctgatggtcgggccc
aacttccgcgtgggcaagaagatcggctgtggcaattttggagagctgaagcttggtaaa
aatctctacaccaacgagtatgtggcaattaaactggaaccagttaagtcgagggcaccg
cagttacatttggagtaccggttttataaaacgttaggaagcacagcagaagggctcccc
caggtgttttactttgggccctgtgggaaatacaatgccatggttctagagcttctgggc
cccagtttagaagacctctttgacctttgtgacagaaccttctcactaaagactgttttg
atgatcgctattcagctgatctcccggatggagtatgtgcactctaaaaacctcatctac
agagacgtaaagcctgaaaactttctcattggacggcaaggatgcaaaaaagaccacatc
atccacatcattgactttggcctggccaaagagtacatcgagcctgaaaccaaaaaacac
atcccatacagggagcacaagagcttgactgggacagcccgatatatgtccattaacaca
catttggggaaagagcaaagtcgtcgagacgatctagaagccttgggtcacatgttcatg
tacttcctccgtgggagtctgccttggcaagggcttaaagcggacacactgaaagagcgc
taccagaagatcggagacacaaaaagaaatactcctgttgaggttctctgtgagagcttc
ccagaggaaatggccacctacctgcgctacgtgagacgcctggatttctttgaaaagccc
gattacgaatacctgaggaccctgttcacggagctgttcgaacggaaaggatacaccttt
gattacacctacgactgggtcggcagacagatacccacaccggtggggtccgtcaacgtg
gactctggagcttctgccatcacaagagagagccatccgcacagagaccggcccgcacag
caccaacccatgaggaatcagactgcagcgtccgaccggcggggagcgtgggaggttcag
cccagtcggacaaactcctcctacatggcctcccacctggcatcggacaggcacgggggc
tcagtgcaggtggtcagctcgaccaatggggagcttaatgtggatgaccctcttgcagcc
cactccaacgcaccaatcacagcccaggccgaggtggaggtagtggatgaggccaactgc
gtgaaaatgctcaacctgtggtgctgctgcttcttcaagcgaaaacgaaagaagaacact
ccgcggcaaaaatga

KEGG   Esox lucius (northern pike): 105018395
Entry
105018395         CDS       T04894                                 

Gene name
csnk1g1
Definition
(RefSeq) casein kinase I isoform X1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105018395 (csnk1g1)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105018395 (csnk1g1)
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105018395 (csnk1g1)
SSDB
Motif
Pfam: CK1gamma_C Pkinase PK_Tyr_Ser-Thr Pkinase_fungal PIP49_C
Other DBs
NCBI-GeneID: 105018395
NCBI-ProteinID: XP_010882073
UniProt: A0A3P8ZGY9
LinkDB
AA seq 465 aa
MDHPREKESERPARSKAGQGRSGHSRPSGSGSSGVLMVGPNFRVGKKIGSGNFGELKLGK
NLYTNEYVAIKLEPIKSRAPQLHLEYRFYKTLGSTAEGLPQVYYFGPCGKYNAMVLELLG
PSLEDLFDLCDRTFSLKTVLMMAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGHKQEHI
IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFM
YFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCESFPEEMATYLRYVRRLDFFEKP
DYDYLRALFTELFERKGYTFDYSYDWDGRPIPTPVGSINMDSGVSAIRESHANRERPSQQ
QPLRNQTAASDRRGAWDAQPHRQTNSSYLSSSHLAVDRHGGSVQVVSSTNGELNADDPLT
AHSNAPITAQAEVEVVEEANCVKMLNLWCCCFFKRKRKKNTPRQK
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggaccacccacgggaaaaagaaagtgagcggccagcgcggagcaaggcgggtcagggg
cgtagtgggcactcccgaccctctgggtcaggctcctcaggagtcctgatggtgggtccc
aactttcgtgtgggcaagaagatcggcagtggtaactttggagagctgaagctaggtaaa
aacctctacaccaatgagtatgttgcaataaaattggaaccaataaagtcaagggcacct
cagttgcatttggagtaccggttttacaaaaccttaggcagcacagcagagggtcttcct
caggtgtactactttgggccctgtggtaaatataatgccatggttttagagctgctgggc
cccagtctagaagacctctttgacctctgtgacaggaccttctctctcaagactgtgtta
atgatggctattcagctactttcccgaatggagtatgtccattccaagaaccttatctac
cgagatgtgaagcctgagaacttcctcattgggcggcaggggcacaagcaggagcacata
atccacatcattgattttggcctggccaaagagtacattgacccagagaccaaaaaacac
atcccctacagagaacacaagagcctcaccgggactgcccgctacatgtctatcaacact
cacttggggaaagagcaaagtcgtcgagatgacctggaagccttaggccacatgttcatg
tatttcctacgggggagtctaccatggcaaggactcaaggctgacaccttgaaagagcgt
taccagaaaattggggacaccaaacgcaacactcccatcgaggtcctctgtgaaagcttt
ccagaagagatggccacatacctgcgctacgttcggcggttggacttttttgagaagcca
gattacgattatttgagggctctattcactgagctgtttgaacgcaaaggatacaccttt
gactactcctacgactgggacggcagaccaattcctacacccgtcggatctattaacatg
gactctggtgtgtctgccatcagagaaagccatgctaacagggaaaggccctctcagcaa
cagcctttaaggaaccagactgcagcatcagaccgcagaggagcatgggatgcacagccc
caccggcaaacaaactcctcctacctgagcagttcccacctggccgtggacaggcatggg
ggctccgtccaggtggtcagctccaccaatggggagctgaacgcagatgacccgttgaca
gcccactccaatgcacctatcacagcgcaggctgaggtggaggtggtggaagaggccaac
tgcgtgaaaatgctcaacctgtggtgctgttgcttctttaagcgaaaacggaagaaaaac
acgccacggcagaaataa

KEGG   Esox lucius (northern pike): 105021152
Entry
105021152         CDS       T04894                                 

Definition
(RefSeq) casein kinase I isoform X1
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
els04540  Gap junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105021152
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105021152
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105021152
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105021152
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105021152
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 105021152
NCBI-ProteinID: XP_010886934
UniProt: A0A3P9A8U0
LinkDB
AA seq 420 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFTAPNS
KGANRAAEAAERERRDREDRLRPGRNPGARGPPAASGRPRGTQDGAPPTPLTPTSHTANM
SPRPASGMERERKVSMRLHRGAPVNVSSSDLTGHQETSRMSTSQMVSGMIPGGLHSAAPR
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggaattgagagtgggaaaccgatataggctgggaaggaaaattggaagtggatctttt
ggagacatctatttgggcacagacatctcagttggtgaggaggtggccataaaactggaa
tgtgtgaagacgaagcatccccagctccatatcgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccataaagtggtgtggagcagagggggactacaacgtcatg
gtcatggagctgctgggacccagtctggaggacctgttcaacttctgctcccgcaagttc
agcctcaagacagtcctactgctggctgaccagatgatcagccgtattgagtacatccac
tctaagaacttcatccacagagacgtgaagccggacaacttcctgatgggccttggcaag
aagggcaacctggtgtacatcatcgactttggcctggccaagaagtaccgcgacgcccgc
acacaccagcacatcccctaccgcgagaacaagaacctgaccggaaccgcacgctacgcc
tccatcaacacacacctgggaatagagcagtcgcgtcgtgacgacctggagtctctaggt
tatgtcctgatgtacttcaacctgggctctctgccctggcagggcctcaaagccgccacc
aagaggcagaagtacgaacgcatcagcgagaagaaaatgtccacccccatcgaggtgctc
tgcaagggctacccctctgagtttgcgacatacttgaacttctgccgttctctgcggttt
gatgacaagccagactactcgtacctaagacaactgttcagaaacctgttccacagacag
ggcttttcctatgactacgtgttcgactggaacatgctcaagtttactgcccctaattcc
aagggggccaaccgggcagcggaggcggcggagcgggagcgcagggaccgagaggatagg
ctgagacctggcaggaaccctggggccagggggccccctgccgcctcaggacgcccccgc
ggaacacaggatggggctcctcctacaccccttacacccacgtcacacacagccaacatg
tctccacggccggcgtccggtatggagagagagaggaaggtgagcatgcggcttcaccgg
ggagctcccgtcaacgtttcctcgtccgacctgacgggacaccaggaaacctcccgcatg
tccacctcacagatggtgtctggcatgatccctggtggcctccactccgctgcgcctcga
tga

KEGG   Esox lucius (northern pike): 105025098
Entry
105025098         CDS       T04894                                 

Definition
(RefSeq) casein kinase I-like
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105025098
   04340 Hedgehog signaling pathway
    105025098
   04068 FoxO signaling pathway
    105025098
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105025098
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105025098
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105025098
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 105025098
NCBI-ProteinID: XP_010893852
UniProt: A0A3P9AEV7
LinkDB
AA seq 419 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEDGERERERREGKDGEERIGGGPRAARALPPGVNPPGGVDRIRNGPNAAASNPASRGVP
QSGNRSPQAVSRAERERKVAMRLHRGAPANVSSSDLTAQMGQSRIATSQVSVPFEHLGK
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggagttgagagtggggaacaagtaccgccttggcagaaagatcgggagcggctctttt
ggcgacatttacctgggtgccaacatcgccacgggtgaggaggtggccattaagctggaa
tgtgtgaagaccaaacatccgcaactacacatcgagagcaagttctacaagatgatgcag
ggaggggtgggcatccctaccataaagtggtgtggagcagagggggactacaacgtcatg
gtcatggagctgctgggacccagtctggaggacctgttcaacttctgctcccgcaagttc
agcctcaagactgtcctactgctggctgaccagatgatcagccgtattgagtacatccac
tctaagaacttcatccacagagacgtgaagccggacaacttcctgatgggccttggcaag
aagggcaacctggtgtacatcatcgactttggcctggccaagaagtaccgcgacgcccgc
acacaccagcacatcccctaccgcgagaacaagaacctgaccggaaccgcacgctacgcc
tccatcaacacacacctgggaatagagcagtctcgtcgtgacgacctggagtctctaggt
tatgtcctgatgtacttcaacctaggctctctgccctggcagggcctcaaagccgccacc
aagaggcagaagtacgaacgcatcagcgagaagaaaatgtccacccccattgaggtgctg
tgcaagggctacccctctgagttctccacatatctgaacttctgccgctctctgcggttc
gatgacaagccagactactcgtacctaagacaactgttcagaaacctgttccacagacag
ggcttttcctatgactacgtgttcgattggaacatgctcaagtttggggccagcaggaca
gctgaggatggtgaaagagagagggagagaagagagggaaaagatggggaagagaggatt
ggagggggacctcgggcagctcgtgccctaccaccaggagtgaacccaccaggaggggtg
gacaggatcagaaacggccctaacgctgctgcctctaaccctgcttccagaggagtccct
cagtcagggaaccggtccccacaggctgtatcccgtgcagagcgtgagaggaaggtggcc
atgagacttcaccgtggcgcccccgccaacgtctcttcctctgacctcactgcacagatg
ggccaatcacgcattgccacatcacaggttagtgtgccatttgaacacctggggaagtga

KEGG   Esox lucius (northern pike): 105025774
Entry
105025774         CDS       T04894                                 

Gene name
csnk1e
Definition
(RefSeq) casein kinase I
  KO
K08960  casein kinase 1, epsilon [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105025774 (csnk1e)
   04340 Hedgehog signaling pathway
    105025774 (csnk1e)
   04068 FoxO signaling pathway
    105025774 (csnk1e)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105025774 (csnk1e)
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105025774 (csnk1e)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105025774 (csnk1e)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 105025774
NCBI-ProteinID: XP_010895023
UniProt: A0A3P8XVY8
LinkDB
AA seq 415 aa
MELRVGNKYRLGRKIGSGSFGDIYLGANIATGEEVAIKLECVKTKHPQLHIESKFYKMMQ
GGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRT
AEEGERRGASERDERIVGVPRGPASRGLPPGPNPPGANRVRNGPEQAASNPASRVQQSGN
TSPRAVSRAERERKVSMRLHRGAPANVSSSDPAARHDQSRISTSQVSMPFEHLGK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggagctgagagtggggaacaagtaccgactggggcggaaaatcgggagtgggtccttt
ggagacatttaccttggtgctaacattgctacaggcgaggaggtggctattaaactggag
tgtgtaaagaccaaacacccacaactccacattgagagcaagttctacaaaatgatgcaa
ggaggagtggggatcccctctataaagtggtgcggggccgagggggactacaacgtcatg
gtgatggaactcctgggtcccagtctggaagacctcttcaacttctgttcccgcaaattc
agcctcaagacggtgctgttgttggccgaccaaatgatcagccgcattgagtacatccac
tccaaaaacttcatccatcgtgacgtcaagcctgacaacttcctaatggggttggggaag
aagggcaacttggtgtacatcattgactttggtctggccaagaagtaccgagacgcccgc
acacatcagcacatcccctaccgagagaataaaaacctgaccggcaccgcgcgctacgcc
tccatcaacactcacctgggaattgagcagtctcggcgtgacgacctggagtctctggga
tatgtcctcatgtactttaacctgggctctctgccctggcaaggcctcaaagctgccaca
aagaggcagaaatacgaacgtatcagcgagaagaaaatgtccaccccaattgaggtgctc
tgcaaaggctacccctccgagttctccacctacctgaatttctgccgctcgctgcggttt
gatgacaagcccgactattcataccttcggcagctcttcaggaacctgttccacagacag
gggttctcctatgactacgtcttcgactggaacatgctcaaatttggggccagtcggacg
gcggaggaaggggagaggaggggagcctccgagagggatgagcgtattgtaggggtccca
aggggacctgcctcgcggggtctaccgccaggaccaaacccacccggtgccaacagagtc
cggaacggaccagagcaagccgcctcaaaccccgcgtcacgggtgcagcagtctgggaac
acgtcgccgcgcgccgtctctcgtgctgagcgggagaggaaggtgagcatgcgccttcac
cgaggagcccctgcaaacgtttcctcctccgaccccgcggcccgccacgaccagtcccgc
atttccacgtcacaggtcagcatgccatttgagcacttggggaagtga

KEGG   Esox lucius (northern pike): 105027198
Entry
105027198         CDS       T04894                                 

Gene name
csnk1a1
Definition
(RefSeq) casein kinase I isoform X2
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105027198 (csnk1a1)
   04340 Hedgehog signaling pathway
    105027198 (csnk1a1)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105027198 (csnk1a1)
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105027198 (csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 105027198
NCBI-ProteinID: XP_010897487
LinkDB
AA seq 364 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSLAVSSSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSGGQGQQAQTPTGKQTDKPKS
NMKG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcaagcagtagcggctctaaagccgaattcattgtcggtggaaaatacaagcttgtc
agaaaaattggatctggatcatttggtgatatatacttggcaatcaacattacaaatgga
gaggaggtagctgtaaaattggaatctcagaaagccagacatcctcaactgttatatgaa
agtaagctgtacaaaatcttacagggaggagttggaatcccgcacataaggtggtatggc
caagaaaaggactacaatgtcctagtgatggaccttctgggacccagtctggaagacctt
ttcaatttctgttcgcgcaggttcacgatgaaaactgtactaatgcttgcggaccagatg
atcagcagaatcgaatatgtgcatacaaagaacttcattcacagagatatcaagccagac
aactttttaatgggaattggccgtcactgtaacaagtgtttagaatctccagtggggaag
aggaaaagaagcttggctgttagttcttctcaggacccatctttctcaggattaaaccag
ttgttcctcatcgactttggtctggccaaaaaataccgggacaacaggacacgacagcac
ataccctacagagaagacaaaaatctcacaggcacagctcgctatgccagcatcaatgca
cacctgggtatcgagcagagtcgccgagatgacatggagtcgctaggatacgtcctgatg
tacttcaacagaaccagcctgccctggcagggactaaaggctgccacaaagaaacagaag
tacgagaagattagcgagaagaagatgtccactccagttgaggtgttgtgtaagggtttc
ccggcagagtttgccatgtacctgaactactgccgtgggctgcggtttgaggaggcgccg
gactacatgtacctgcgtcagctgttccgcattctcttcaggactctgaaccaccagtat
gactacacgtttgactggaccatgctgaagcagaaagcagcccagcaggccgcatcctca
gggggacaggggcaacaggcacaaacccccacaggcaagcaaactgacaaacccaagagt
aacatgaaaggttag

KEGG   Esox lucius (northern pike): 105031325
Entry
105031325         CDS       T04894                                 

Definition
(RefSeq) casein kinase I
  KO
K08959  casein kinase 1, delta [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
els04540  Gap junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105031325
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105031325
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105031325
Protein kinases [BR:els01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   105031325
Chromosome and associated proteins [BR:els03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    105031325
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal APH Pox_ser-thr_kin Kdo
Other DBs
NCBI-GeneID: 105031325
NCBI-ProteinID: XP_010903971
UniProt: A0A3P8ZX48
LinkDB
AA seq 407 aa
MELRVGNRYRLGRKIGSGSFGDIYLGTDISVGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGANRA
AEDAERERRAGEDRLRQGQARAPAGARGIPAASGRPRVTQDAAAPSPLTPTSHTGMERER
KVSMRLHRGAPVNISSSDLTGRQDSRMSTSQGLSRVTPSGLQSAAPR
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggaattgagagtgggaaaccgatacagattgggcagaaaaattggaagtggctcgttt
ggagacatttatttgggcacggacatctctgtgggagaggaagtggccatcaagctggag
tgtgtgaagaccaagcacccacagctccacatagagagcaagatctacaagatgatgcag
ggaggagtgggcatccccactataaagtggtgtggagctgagggggactacaacgtgatg
gtgatggagctactaggccccagtctggaggacctcttcaacttctgctcccgcaagttc
agcctcaagacggtcctgctgctggccgaccagatgatcagccgtatcgagtacatccac
tccaagaacttcatccacagggacgtgaagccagacaacttcctgatgggcctgggcaag
aagggcaacctggtgtacatcatcgactttggcctggccaagaagtaccgcgacgcccgc
acccaccagcacatcccctaccgtgagaacaagaacctgaccggcaccgcgcgctacgcc
tccatcaacacacacctgggaatcgagcagtctcgtcgtgacgacctggagtcgctgggc
tacgtcctcatgtacttcaacctgggctctctgccctggcagggactcaaggccgccacc
aagagacagaagtacgaacgcattagcgagaagaaaatgtccacccccatcgaggtcctt
tgcaagggatacccctcggagtttgccacgtacctgaacttctgtcgttctctgcgtttc
gatgacaagcccgactactcgtacctcaggcagctgttccggaacctgttccaccggcag
ggcttctcttacgactatgtcttcgactggaacatgctcaagtttggggctaacagggca
gctgaggatgcagagagagagaggagagctggggaggaccgcttgagacagggacaagcc
agagcccccgccggagcccgaggtatccccgccgcctccggacgaccccgcgtcacccag
gacgccgccgcgccgtctccgctcacacccacctcacacacaggcatggagcgtgagagg
aaggtgagcatgcgcctccatcggggagctccggtcaacatctcctcctcagacctgact
ggccgacaggactcacgcatgtccacctcacagggtctctcccgtgtcacccccagtggc
ctccagtctgcagcccctcgatga

DBGET integrated database retrieval system