KEGG   Esox lucius (northern pike): 105009663
Entry
105009663         CDS       T04894                                 

Gene name
smurf1
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF1 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
els  Esox lucius (northern pike)
Pathway
els04120  Ubiquitin mediated proteolysis
els04144  Endocytosis
els04340  Hedgehog signaling pathway
els04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105009663 (smurf1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105009663 (smurf1)
   04350 TGF-beta signaling pathway
    105009663 (smurf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105009663 (smurf1)
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     105009663 (smurf1)
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    105009663 (smurf1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105009663 (smurf1)
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  HECT type E3
   105009663 (smurf1)
Mitochondrial biogenesis [BR:els03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    105009663 (smurf1)
SSDB
Motif
Pfam: HECT WW C2 Laminin_G_2
Other DBs
NCBI-GeneID: 105009663
NCBI-ProteinID: XP_028979488
LinkDB
AA seq 741 aa
MSGPGSRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKVVVDGSGQCHSTDTVKSTLDP
KWNQHYDLYIGKTDSITISLWNHKKIHKRQGAGFLGCIRLLSNAISRLKDTGYQRLDLCK
LNPSDSDVVRGQIVVSLQTRDRIGGGGPVVDCRGLLENEGPVFEGCFSEEPLPYSDPTGA
AGGGTCRLDSPNQENRLQAQRIRGQDSRGHTHTPQNRPLVNQSPDLPEGYEQRTTVQGQV
YFLHTQTGVSTWHDPRIPRDLTSVSCEELGPLPSGWEVRSTVSGRIYFVDHNNRTTQFTD
PRLHTIISQHSQVKESSQPLGGGGMEVGGEEGGGEGEVTLRYERDLVHKLKLLRHELSLQ
QPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLC
HEMLNPYYGLFQYSTDNIYTLQINPDSSINPVSLKTLQVNPDSSINPDHLSYFHFVGRVM
GLAVFHSHYINGGFTLPFYKQLLGKPITLQDLDSTDPELHKSLVWILENDITSVLDHTFC
VEHSAFGKFLQHELKPNGRNIPVTEENKKEYVRLYVNWRFLRGIEAQFLALQKGFSELIP
QHLLKPFDHKELELIIGGLGKIDLADWKSNTRLKHCAVDSNVVRWFWEAVESFTEERRGR
LLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPYES
YEKLYEKLLTAVEETCGFAVE
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgtcgggtcctgggtctcgaaggaacgggtccagcatcaaaatccggctgacagtatta
tgtgccaagaacctcgcaaaaaaagacttcttccggttgccagacccgtttgctaaggtt
gtcgtggatggatccggacagtgccattctacagatacggtgaagagcacattagatccc
aaatggaaccagcactacgacctctacatagggaagacagactccattaccatcagtctg
tggaaccataagaagatccacaagaggcagggtgccgggttcctgggctgcatacgactc
ctctccaatgccatcagccggctgaaagataccggctaccagcggttggatctgtgtaag
ctgaacccttcagacagcgatgtggttcgagggcagatcgtagtgagtctccagaccaga
gatcgtattggaggcggaggaccagtggtggactgtagaggacttctagagaatgagggg
cctgtgtttgaggggtgttttagcgaggagccgctaccatactcagaccccacaggcgct
gctgggggtgggacctgtcgccttgattcgcctaaccaagagaatcggctccaggctcag
cgaatcagaggccaagattcccgaggccacacccacacacctcagaaccgaccacttgtc
aaccaatcacctgatctgcccgagggatatgaacaacgcaccaccgtgcagggccaagtg
tattttcttcacacacagacaggagtcagcacctggcatgacccacggatacccagggac
ctgaccagtgtgagctgtgaggagttgggtcccctgcccagcggctgggaggtgaggagc
acagtgtcagggcggatctactttgtggaccacaacaaccgaaccacacagttcactgac
ccccgactacacaccatcatcagccaacactcccaggtgaaggagtcttctcaaccgctg
ggtggaggagggatggaggtgggtggggaggagggaggaggagagggggaggtgactctt
cgctacgagagagatctggtccataaactgaagctgctccgacatgaactgtcgctacaa
caaccacaggcaggacactgtcgaatagaggtttccagagaggagatatttgaggagtca
tatcgtcagatcatgaagatgagaccaaaggatctgaagaaacgtctcatggtgaagttt
agaggagaagaagggctggattacggaggggttgccagggagtggctctatctgctttgc
catgagatgttgaatccatactatggtctgttccagtactctacagataacatctatacc
ctacagatcaatcctgactcctctatcaaccctgtgagtttaaaaacactacaggtcaat
cctgactcctctatcaaccctgaccacctgtcatatttccactttgtgggacgtgttatg
ggtctagccgtgttccatagtcattacatcaatggaggcttcacgctgcccttctacaaa
cagctgctggggaaacccatcaccctgcaagacctggacagcaccgacccggaactacac
aaaagtctggtctggatcctagagaatgacatcacgtcggttctagatcacacgttctgc
gtggaacacagtgccttcggaaagttccttcaacacgagctaaaacccaacgggcggaac
atcccggttacagaggaaaacaagaaggagtatgtgcgtctgtatgtcaactggaggttc
ctgaggggcattgaagcccagttcttggctttgcagaaaggattcagcgaactgatccct
caacacctccttaaaccctttgaccacaaggagctagagttgatcattggaggtttggga
aagatcgatcttgctgactggaaatccaacacgcgtctcaagcactgtgctgtagacagc
aatgtggtgcgctggttctgggaggctgtggagagttttactgaggagagaagaggacgc
ttgctgcagtttgttaccggctctaccagagtacctctacaaggtttcaaggctctgcag
ggttctacaggtgcagcaggcccaaggctgtttaccattcacctgatagacgccaacaca
gacaacctacccaaggctcacacgtgttttaacaggatagatatccctccctacgagtcc
tacgagaaactttatgagaaactgctgacggccgtggaggaaacctgtggattcgctgtg
gagtga

KEGG   Esox lucius (northern pike): 105013159
Entry
105013159         CDS       T04894                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
els  Esox lucius (northern pike)
Pathway
els04120  Ubiquitin mediated proteolysis
els04144  Endocytosis
els04340  Hedgehog signaling pathway
els04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105013159
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105013159
   04350 TGF-beta signaling pathway
    105013159
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105013159
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     105013159
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    105013159
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105013159
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  HECT type E3
   105013159
Mitochondrial biogenesis [BR:els03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    105013159
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 105013159
NCBI-ProteinID: XP_010872801
LinkDB
AA seq 788 aa
MSNQGVRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDMNKL
GPNDSDTVRGQIVVSLQSRDRIGSGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTSLPELGVPLRLLPVPSRPASEYSSPGRPLSCIVDENTPILSTNGDTPTVPC
VPSSDQRAQERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH
DPRVPRDLSNVNCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNP
SPNGSRGCIENQNSQISRQNQLKEQAQQVLVSPGNLPEEAECLTVPKYKRDLVQKLKILR
QELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMVKFKGEEGLDYGGVARE
WLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYI
DGGFTLPFYKQLLGKPITLGDMESVDPDLHNSLVWILDNDITGVLDHTFCVEHNAYGEII
QHELKPNGKSIQVTQDTKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKAFDEK
ELELIVCGLGKIDINDWKSNTRLKHCTADSNIVKWFWRAVESYDEERRARLLQFVTGSSR
VPLQGFKALQGAAGPRLFTIHQIDASSNNLPKAHTCFNRIDIPPYEHYDKLYDKLLTAIE
ETCGFAVE
NT seq 2367 nt   +upstreamnt  +downstreamnt
atgtctaaccaaggagttcggcgtaacggtcctgttaagctgcgtttaacagtcctctgc
gccaaaaacctggtgaagaaagacttttttcgcctccctgatccctttgccaaagtggtg
gtggacggctcaggacaatgtcactccacagacactgtgaagaacaccctggaccccaag
tggaaccagcactacgacttatacattggcaagtctgactccatcaccatcagcgtgtgg
aaccacaagaagatccacaagaagcagggggccggcttcctgggctgtgtgcgcctgctg
tccaacgccatcaaccgcctcaaagacacaggctatcagaggctggacatgaacaagctg
ggccccaatgacagtgacacagtgaggggtcagatagtagtgagcctgcagtccagagac
cggataggctcaggaggccctgtggttgactgcagtcgtctgtttgacaatgacctgcca
gatggctgggaggagcggaggactgcgtctggcaggatccagtacttgaaccacatcacg
cgcactacacagtgggagaggcctaccagcctccctgagcttggtgtccctcttcgcctt
ctccccgttccctccaggcctgcatcagagtactccagccccggccggcctctcagctgc
atcgtggacgagaacacgcccatcctgagcaccaatggggacacgcccaccgtcccgtgc
gtgccgtccagtgaccagcgggcccaggagagacgcgtccgctcccaaagacaccggaac
tacatgagcaggacacacctgcacacaccgccagacctgcccgagggatacgagcagagg
accacgcagcagggccaggtgtacttcctccacacccagacaggagtcagcacttggcat
gaccctcgggtgcccagagacctaagtaatgtaaactgtgaggagctgggtccactgccc
cctggctgggaaattaggaacacagctaccggacgggtctacttcgtcgatcacaacaac
cgcaccacgcagttcaccgacccgcggctttcagccaacctgcatctagtcctcaaccca
agccctaacggttcccgtggctgcatcgaaaatcagaacagtcagatcagccgtcagaac
cagctgaaggagcaggcacagcaggtgctggtgtctccgggtaatctgccagaggaagca
gagtgcctcacggtgcccaaatacaagagggacctggtgcagaagctgaagatcctccgc
caggagctgtcccagcaacagcctcaggcaggccactgccgtatagaagtgtcccgtgag
gagatctttgaggagtcttatcgacaggtgatgaagatgaggcctaaggacctgtggaag
agattgatggtgaagtttaaaggggaggaggggctggattacggaggggtggccagggag
tggctgtatcttttgtcccatgagatgctgaatccatactatggcctgttccagtactcc
cgtgacgacatatacaccctacagattaacccagactccgccgtaaacccggagcatctg
tcctacttccactttgtgggtcgtatcatgggcatggcggtgttccacggccactacatc
gacgggggcttcaccctgcccttctacaagcagcttctgggtaaacccatcaccctgggc
gacatggagtccgtggacccggacctccacaacagtctcgtctggatcctggacaatgac
atcacaggagtgctggaccacaccttctgtgtggagcacaatgcctacggggagatcata
cagcacgaactcaaacccaatggcaagagcatccaggttacccaggacaccaagaaggag
tatgtcagactgtatgtgaactggcgtttcctgcgaggcatcgaggcccagttcctggcc
ctgcagaagggcttcaacgaggtcatcccacagcatcttctcaaggccttcgacgagaag
gagctggagctcatagtgtgtggcctgggcaagatcgacatcaatgactggaagtccaac
accaggctgaagcactgcaccgctgacagcaacatcgtcaagtggttctggagggccgtg
gagtcttacgacgaggagcgccgggccaggctgctgcagtttgtcaccggctcctccagg
gtgcccctacagggcttcaaagccctccaaggtgcagcgggcccacgactcttcaccatc
caccagatcgacgccagctccaacaacctgcccaaagcccacacctgcttcaaccggatc
gacattcctccctatgagcactatgacaagctttatgacaagcttctcactgccatcgag
gagacgtgtggctttgctgtggagtga

KEGG   Esox lucius (northern pike): 105021636
Entry
105021636         CDS       T04894                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
els  Esox lucius (northern pike)
Pathway
els04120  Ubiquitin mediated proteolysis
els04144  Endocytosis
els04340  Hedgehog signaling pathway
els04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105021636
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105021636
   04350 TGF-beta signaling pathway
    105021636
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105021636
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     105021636
Membrane trafficking [BR:els04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    105021636
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105021636
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  HECT type E3
   105021636
Mitochondrial biogenesis [BR:els03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    105021636
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 105021636
NCBI-ProteinID: XP_010887727
LinkDB
AA seq 804 aa
MSNQGVRRNGPVKLRLTVLCAKNLSKKDFFLVNTILHFGSSSTGLPDPFAKVVVDGSGQC
HSTDTVRNTLDPKWNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRL
KDTGYQRLDLNKLGPNDNDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERR
TASGRIQYLNHITRTTQWERPTRPASEYSSPSGRPLSCVVDENTPVMTPNGAATGVLPSG
GSDPRAQERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDP
RVPRDLSNVNCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNSNG
PSPNGPSGPSPNSSRVAMDSQSQNTNLSGRQSNQLKETQPPQQAPTLSPAQLPEEAECLT
VPKYKRDLVQKLKILRQELSQQQPQAGHCRIEVCREEIFEESYRQVMKMRPKDLWKRLMV
KFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFH
FVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHKSLVWILDNDITGV
LDHTFCVEHNAYGEIIQHELKPNGKSVSVSEDTKKEYVRLYVNWRFLHGIEAQFLALQKG
FNEVIPQHLLKSFDEKELELIVCGLGKIDIADWKSNTRLKHCTAESNVVKWFWRAVESYD
EERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDANTNNLPKAHTCFNRIDVPA
YEHYDKLYDKLLTAIEETCGFAVE
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgtctaatcaaggagttaggagaaatggcccagtgaaactgcggttgacagtcctgtgt
gcgaagaacctgtcgaagaaagacttcttccttgtgaatacaatcctccattttggctcc
tcctccacagggctgcctgacccctttgccaaagtggtagtggacggctcggggcaatgc
cactctacggacactgtaaggaacaccctggatcccaagtggaaccaacattacgacctg
tacatcgggaagtctgattctatcactataagtgtgtggaaccacaagaagatccacaag
aagcagggtgccggcttcctgggctgtgttcgcctgctctccaacgccatcaaccgcctc
aaagacactggctaccagagactggacctgaataagctgggccccaatgacaacgacacg
gtcagaggccagatagtggtgagcctgcagtccagagaccgtatcggcacaggaggcccg
gtggtggactgcagtcgtctgttcgacaacgatttacccgacggctgggaggagagaagg
acagcctctggtcggatccagtaccttaaccacatcacacgcaccacgcaatgggaaagg
cccacccggccggcgtcggagtactccagcccctccgggcggcctctcagctgcgtggtg
gatgagaacacgccggtcatgacgcccaacggggcggccaccggcgttctgcccagcggc
gggagcgacccgcgggcccaggagaggcgcgtccgctcgcagaggcacaggaactacatg
agcaggacacacctacacaccccgccggacctgcccgaaggatacgaacaacggaccact
caacagggccaggtctacttcctccacactcagacgggcgtcagcacgtggcacgacccc
cgagtgcccagggatctgagcaatgtcaactgtgaggagctgggccctctgccacctggc
tgggagatccgcaacacagcaacaggccgggtctactttgtggaccacaacaaccgaacc
acgcagttcaccgacccgcgcctctccgccaatctccacctggtccttaattcaaacggc
ccaagtccaaacggtccatccggcccgagtccaaacagctcccgtgtggctatggacagc
cagagccagaacactaacctcagtggtcgccagtctaaccagctgaaggagacgcagcca
ccccagcaggcgccgacgctgtctccggcccagctccccgaggaggctgagtgcctcacc
gtgcccaagtacaagagggacctggtacagaagctgaagatcctccgccaggagctgtcc
cagcaacagccccaggcaggacactgtcgcatcgaggtctgccgcgaggagatcttcgag
gagtcataccgacaggtgatgaagatgcgtcccaaggacctgtggaagagactgatggtg
aagttcagaggagaagagggcctggattatgggggggtggccagggagtggctgtacctg
ttgtctcacgagatgttgaacccgtactacggcttgttccagtactccagagatgacatc
tacacactgcagatcaaccctgacagcgctgtgaacccggagcacctctcctacttccac
ttcgtgggtcgtatcatgggcatggcggtgttccacggccactacatcgacgggggcttc
accctgcccttctacaagcagctgctgggcaaacccatcaccctggacgacatggagtct
gtggacccggacctccacaagagcctggtctggatcctggacaatgacatcacgggcgtg
ctggaccatacgttctgtgtggagcacaacgcctatggggagatcatccagcacgaactc
aaacccaacggcaagagtgtctccgtcagcgaggacaccaagaaggagtatgtgagactg
tatgtgaactggcggttcctccacggcatcgaggctcagttcctggccctgcagaaaggc
ttcaatgaggtcatcccccagcacctgctcaagtcctttgacgagaaggagctcgagcta
atcgtgtgtggcctggggaagatcgatatcgccgactggaagagcaacacgcgcctgaag
cactgtacggccgagagcaacgtggtcaagtggttctggagggccgtggagtcctacgac
gaggagcgccgagcccggctgctgcagtttgtcaccgggtcgtccagagtccctctgcag
ggcttcaaggcacttcaaggtgcggcaggacccaggctcttcaccatccatcagattgat
gccaacaccaacaatctacccaaagcccacacctgctttaaccggatagacgttccagcc
tacgagcactatgacaagctgtacgacaagctgctgacagctatcgaggagacctgcggc
tttgccgtggaatga

DBGET integrated database retrieval system