KEGG   Esox lucius (northern pike): 105009930
Entry
105009930         CDS       T04894                                 

Gene name
spopl
Definition
(RefSeq) speckle-type POZ protein-like
  KO
K10523  speckle-type POZ protein
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105009930 (spopl)
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     105009930 (spopl)
SSDB
Motif
Pfam: BTB MATH BTB_2
Other DBs
NCBI-GeneID: 105009930
NCBI-ProteinID: XP_028971594
LinkDB
AA seq 392 aa
MSRVPTPPPPGEMSAGPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQSNMNMLK
VPECQLSDDLGNLWECSRFTDCSLYVGGQEFKAHKSILAARSPVFNAMFEHEMEESKKNR
VDISDVDPDVFKEMMGFIYTGKAPNLEKMADNLLAAADKYALERLKVMCEEALCNSLSVE
NVADTLILADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNHATDIMETAGWKSMI
QSHPHLVAEAFRALASAQCPPFGLPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcacgggttcccacccctcctccacctggggagatgtctgctggacctgtggcggag
agctggtgttacacacaggtaaaagttgtgaagttttcctacatgtggaccatcaacaac
ttcagtttctgcagggaggagatgggggaggtgttaaagagttcaacattctcctcaggg
cctaatgacaagatgaaatggtgtctgagagtaaaccccaaaggcctggatgatgagagt
aaagattatctgtcattgtatttacttcttgttagttgtccaaaaagtgaagtcagagcg
aagttcaagttttccttattgaacgctaaaagagaagagactaaagctatggaaagccaa
agagcctataggtttgtccaggggaaggactggggcttcaaaaagtttattagaagagat
ttcctgcttgatgaagccaatggactacttcctgacgacaagctcactctgttttgtgag
gtgagtgttgtacaggactctgtaaacatatcaggccagtccaatatgaacatgttgaag
gttccagagtgccagctgtcagatgacttggggaacctctgggagtgttctcgattcact
gactgttccctgtatgtgggcgggcaggagttcaaggcacacaaatctattctggcagcg
agatcccccgtctttaacgccatgtttgaacatgagatggaagaaagtaaaaagaaccgt
gtggacatcagtgatgtggacccagatgtgtttaaggagatgatgggtttcatctacaca
ggaaaagcccccaacctggagaagatggctgacaatctgcttgctgctgccgacaaatac
gcattggagcgtttaaaggtgatgtgtgaagaggctctgtgcaacagcctctcagtggag
aatgtggctgatactctcatcctggctgacttgcacagcgcggagcagctcaaagcacaa
gccatagattttatcaacaggtgcagcgtcctccgacagctgggctgtaaagatgggaaa
aactggaatagcaatcatgccacggacatcatggaaacagccggctggaagtcaatgatc
cagtcccatccacacttagtggccgaggccttccgggccctggcatcggcacagtgccca
ccctttggcttgccacgcaaacgcctaaaacagtcatga

KEGG   Esox lucius (northern pike): 105030301
Entry
105030301         CDS       T04894                                 

Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105030301
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     105030301
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 105030301
NCBI-ProteinID: XP_010902360
UniProt: A0A3P8Z940 A0A3P8Z8S5
LinkDB
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKAEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPDCRLADELGGLWENSRFTDCSLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTDKAPNLDKMADDLLAAADKYALERLKVMCEDALCTSLSVE
NAAEILILADLHSADQLKTQAVDFINYHAAEVMETAGWKSMVASHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagagtcccgagtccccctccccctgcggaaatgtccagcgggcctgtggcggag
agctggtgctatactcagattaaagtggttaagttctcctacatgtggaccatcaacaac
ttcagtttttgtcgcgaggagatgggcgaggtcattaagagctccaccttctcttcagga
gccaatgacaagcttaaatggtgtctgcgggtgaaccccaaagggctggatgaggagagc
aaagactacctttccctctatctgctcctggtcagttgtccaaaggctgaggtgcgcgcc
aaattcaagttctccatcctcaacgccaagggagaggagaccaaagccatggaaagccag
agagcatatcggtttgttcaggggaaggactggggcttcaagaagttcatccgccgagac
ttcctgttggacgaggccaacggtcttctgccagacgataagcttaccttgttctgtgag
gtaagtgtggtgcaggactctgtaaacatctcaggtcagaataccatgaatatggtgaag
gtgccggactgcagacttgctgacgagctgggcgggctatgggagaactcacgcttcaca
gactgctccctgtgtgtggccgggcaggagttccaggcccacaaagccatcctggcagct
cgctctcctgtgtttagtgccatgtttgagcatgagatggaggaaagcaagaagaaccga
gtggagatcaatgacgtggagccggaggtcttcaaagaaatgatgtgtttcatctacaca
gacaaggcccccaatttggacaagatggcagatgatcttctagcagccgctgacaagtat
gccctggagaggctgaaggtgatgtgtgaggacgctctctgcaccagtctttctgtggag
aatgccgcagagatcctcattctggcagacctgcacagtgctgaccagctcaaaacccag
gcggtggacttcatcaactaccatgctgctgaggtgatggagacggcaggctggaagtcc
atggtggcctcccaccctcacttggtggctgaagcctaccgctcactagcctcggcccag
tgccccttcctggggccgccccggaagcgcctcaaacagtcttaa

DBGET integrated database retrieval system