KEGG   Esox lucius (northern pike): 105010143Help
Entry
105010143         CDS       T04894                                 

Gene name
pycard
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
els  Esox lucius (northern pike)
Pathway
els04217  Necroptosis
els04621  NOD-like receptor signaling pathway
els04623  Cytosolic DNA-sensing pathway
els04625  C-type lectin receptor signaling pathway
els05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    105010143 (pycard)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    105010143 (pycard)
   04623 Cytosolic DNA-sensing pathway
    105010143 (pycard)
   04625 C-type lectin receptor signaling pathway
    105010143 (pycard)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105010143 (pycard)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN
Motif
Other DBs
NCBI-GeneID: 105010143
NCBI-ProteinID: NP_001297954
UniProt: C1BXR4
LinkDB All DBs
AA seq 192 aa AA seqDB search
MSKTVSDAIINVLDGLGEAGLKRFRRKLCDCKRDQGPVIRFGKVEKADADDLVLILIRTY
TENGALDVAIEVLEAIGDKESAEELMDFQKSRNKSPGPSVPGDPGQHFVDLYRKDLIERV
SQVDPILDSLLQRKVIQQSAYSDVRSERTSQKRMRELYEGPVKGFGVSGKDIFLEILTEH
EPYLISDLKGEK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaaacggtcagcgatgcaataattaatgtgctcgatggtttaggagaggctggt
ttgaagagattcagacgtaaactctgtgattgcaagagggaccaggggccagtaattcgt
tttggcaaggttgagaaagcggacgctgatgacttggtacttattttgatccgtacctac
actgaaaacggggctttggatgtggctatagaggtcttggaagcaattggtgacaaagaa
tctgcagaagaattgatggattttcagaagtcccgcaataaatcacctggtccatctgtc
cctggagacccaggccaacactttgtggacttgtatcggaaggatctgatcgaacgagtg
tcccaggtggaccccatcctggatagtctactgcagaggaaagtcatccaacaaagtgcc
tacagtgatgtgaggtctgaaagaaccagccagaaaaggatgagagagctctatgaagga
cctgtgaaaggatttggtgtcagtggcaaagatatatttttagagattctgacagagcac
gaaccataccttattagtgacctaaagggagaaaaatga

DBGET integrated database retrieval system