KEGG   Esox lucius (northern pike): 105011077Help
Entry
105011077         CDS       T04894                                 

Gene name
erg
Definition
(RefSeq) transcriptional regulator ERG isoform X4
  KO
K09435  transcriptional regulator ERG
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105011077 (erg)
Transcription factors [BR:els03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    105011077 (erg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_3
Motif
Other DBs
NCBI-GeneID: 105011077
NCBI-ProteinID: XP_019904046
UniProt: A0A3P9A1Y7
LinkDB All DBs
AA seq 480 aa AA seqDB search
MIQTGTDPAGPAKEALSVVSEDQSLFECTYGTPHHAKAEMTAAAASEYSQAAKMSPRVHQ
QDWLSQTSTRVTIKMEGNSGHVNGSRNSPDNCSVGKNGKLPSGVEGTVPVTYSSYLEDKH
IAPPNMTTNERRVIVPADPTLWSTEHVRQWLEWAVKEYGLLEVDVALFHNVDGKDLCKMS
KEDFQRLTLSYNADILLSHLHYLRERGASFIFPNTPVYPTDTSPRVSHRPDLAYEAARRS
GWAPQAVSSTKGSQTSPAIVTKTEEQRPQLDPYQILGPTSSRLANPGCGRDSNKPQSADI
ALLLSFKGSGQIQLWQFLLELLSDSANSGCITWEGTNGEFKMTDPDEVARRWGERKSKPN
MNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSMYKYPSDLSYMS
TYHAHQQKVNFVTPHPPALPVTSSSFFAAPNPYWNSPTGGLYPNTRHPAAHMPSHLGTYY
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgattcagactggaacggaccctgcaggccccgccaaagaagctttgtccgtggtgagt
gaggaccagtcgctgtttgagtgtacctacggaacgcctcaccacgccaaggcggagatg
acggcggcagcagccagcgagtacagccaggcagctaagatgagccccagggtgcaccag
caggactggctgtcccagacgtccacacgcgtcaccatcaagatggaaggcaacagtgga
cacgtcaacggcagcaggaactctcctgacaactgcagtgtggggaagaacgggaagctg
cccagcggagtggagggcacagtccctgtcacctacagcagctacctggaggataagcac
atcgctccccccaacatgaccaccaacgagcggcgcgtcatcgttcctgcagaccccacc
ctctggtcgacggagcacgtgcgccagtggctggagtgggcagtgaaggagtacggcctg
ctggaggttgacgtggctctcttccacaacgtggacggcaaggacctgtgtaagatgagc
aaggaggacttccagaggctcacgctcagctacaacgcagacatcctgctctcccacctg
cactacctcagagagaggggtgcaagttttattttccccaacactcctgtctatcccaca
gatacctcccccagagtttcccatcgtccagacctggcatatgaagctgcaagacgatct
ggatgggctccacaagctgtgtcttccaccaaaggttcccagacctcgccagccattgtc
accaaaacagaggagcagagacctcagctcgatccttaccagatcctgggtcccacaagc
agcaggctggcaaaccctggctgtggccgggactcaaacaaaccgcagtctgccgacatc
gcactactcttgagcttcaaaggctcaggacagatccagctgtggcagttcctcctggag
ctcctgtcagacagcgccaactccggctgcatcacctgggagggcaccaacggtgagttc
aagatgaccgaccccgacgaggtggcgaggcgctggggcgagaggaagagcaagcctaac
atgaactacgacaagctgagccgcgccctgcgctactactacgacaagaacatcatgacc
aaggtgcacggcaagcgctacgcctacaagtttgacttccacggcatcgcccaggccctg
caaccccacccgccagagtcctccatgtacaagtacccctccgacctgtcctatatgagc
acctaccatgcacaccaacagaaggtcaactttgtcactcctcatcccccagcgctgcct
gtcacctcctccagcttctttgctgctcccaatccctactggaactctcccaccgggggc
ctctaccccaacacccggcacccagccgcccacatgccctcccacctgggcacctactat
tag

DBGET integrated database retrieval system