KEGG   Esox lucius (northern pike): 105011107
Entry
105011107         CDS       T04894                                 

Gene name
tmem25
Definition
(RefSeq) transmembrane protein 25
  KO
K22652  transmembrane protein 25
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:els04515]
    105011107 (tmem25)
Cell adhesion molecules [BR:els04515]
 Immunoglobulin superfamily
  TMEM25
   105011107 (tmem25)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set
Other DBs
NCBI-GeneID: 105011107
NCBI-ProteinID: XP_010869228
UniProt: A0A3P8ZU91
LinkDB
AA seq 386 aa
MQWVCVKQGPGTSVLLMNTLAWVWTGAIEHVPKIDGQHRAALTLKENVTHKFNCQSEGWN
PQAPPLLTWYLNGERQRPPSEKHAAGRLMITSHEESGMTKPNSKHNSTFSLRARKWDREL
VCAVSGPHSGESYNATVTLNVQFQPEILRVTAHYTETSEPGLSLVLFALVRSNPPAHITW
VDHSGQQVANTSDFLILDSRSYPWLTNHTLRVNLGSLSGNVSVNASNSIGAVQSNLTLAG
LTEFLQSRVEVSVLGILTGGAVGFITLLVLSLLVLCLLHKNKTKAIVDEPIEIIMEKKRI
ESPTVKIDKMHLPRENMSLPSNLQLNDLNTLRKAREAARHRLGEARRDDEEDEDLSAAYA
ARGFARYPMIGYIYKVNSMSSDEIWL
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgcagtgggtgtgtgtgaaacaggggccaggcacctccgtcttgctgatgaacaccttg
gcctgggtctggacaggtgcaattgaacatgtccccaaaatagatggtcagcatcgtgct
gcactcactctgaaagagaatgtcacccacaagttcaactgccaatcggagggctggaat
cctcaggccccgcccctgctgacgtggtacctcaacggggaacgccagagaccaccgtcc
gagaaacatgcagcagggcgcctgatgatcacctcacacgaggagtctggaatgacgaag
ccgaactccaagcacaacagcaccttctctctgagagccaggaagtgggacagggagttg
gtgtgcgccgtctctggccctcacagtggagagagctacaacgccaccgtcactctcaat
gtgcagttccagccagagattctgcgtgtgactgcacactacacagaaacctcagaaccc
ggcctctccctggtcctctttgctttggtacgatccaacccccccgcccacattacctgg
gtggaccattcgggccagcaggtggccaacacatccgacttcctcatcctggactcgaga
agctatccctggctgaccaaccacacacttcgggttaacctaggcagcctgtcaggaaat
gtctctgtgaatgccagtaacagtattggtgctgtgcaaagcaacctaactttggcaggt
ctgacagaattcctccagtccagggtggaggtgtcagtactgggcatcctgacagggggc
gctgtgggctttatcaccctcctcgtcctcagccttctggtgctctgccttctgcacaag
aacaagacgaaagccatcgtcgatgagccaatagagattataatggagaagaaacgtatc
gagtcgcccactgtgaagattgacaagatgcatttacccagagagaacatgtccttacct
tccaacctacaactgaacgacctcaacaccctgcgtaaagcacgggaggctgccagacat
cgcctgggtgaggcgaggagggacgatgaggaagatgaggacctgtctgccgcctacgct
gccaggggctttgcgcgctaccctatgattggctacatctacaaggtgaacagcatgagc
agtgacgagatctggctctga

DBGET integrated database retrieval system