KEGG   Esox lucius (northern pike): 105011238
Entry
105011238         CDS       T04894                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105011238 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105011238 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:els03310]
    105011238 (nr3c1)
Transcription factors [BR:els03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    105011238 (nr3c1)
Nuclear receptors [BR:els03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   105011238 (nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 105011238
NCBI-ProteinID: XP_010869409
UniProt: A0A3P8Z8S2
LinkDB
AA seq 759 aa
MDQSGLKRSRNQDNSSPFSDSPERGVQKNLSGDAGGSKSTAAASRMHLPGSRAPPSATDS
SNGLNVFMAQGEFDMPGTASTVKVAEMKVGGKVLRESHTDKQNPQQQLFENFAMLEESIA
DLNRSNTLGSSVLGHHDLFSFKNEDLSSMDKDMLDTGRVSFEQSQKDLDLSDRLLGDNTM
DILQDLDLPGSLSDLNEFYVADEVAFLSSLSGDDALPGESNVESKPVVSSNGGKRANVKF
VEQQELLEPVIKTEMDTDSSFIQLCTPGVIKQESESRRYCQMPNLDMPGTHSSLGTLSGS
SYHYGASASSAVSLQQDQKPVFGLYPPLSSVSDGWNPGTGHRDGSGVSSPSASSFPVGFS
SSTARPEGSTSTASAPAKSSGPSHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRA
RQNTDGQHNYLCAGRNDCIIDKVRRKNCPACRFRKCLQAGMNLEARKNKKLIRLKGQQAS
PETSLPAPDERAFALIPKSLPQLVPTMLSLLKAIEPEAIYSGYDSTIPDTSTRLMTTLNR
LGGQQVISAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGGMLCFAP
DLVINDERMKLPYMTDQCEQMLKISTELLRLHVSYDEFLCMKVLLLLSTVPKDGLKSQAV
FDEIRMTYIKELGKAIVKREENSSQNWHRFYQLTKLLDSMQEMVGGLLQICFYTFVNKSL
SVEFPDMLAEIISNQLPKFKDGSVKPLLFHNALNHDQMP
NT seq 2280 nt   +upstreamnt  +downstreamnt
atggatcagagtggactgaaacgcagccgtaaccaggacaacagctcgcctttttctgac
agcccagagagaggtgtacagaaaaatctgtcaggtgacgcaggtggttcaaagtccacc
gcagcagcttctaggatgcatctgcctggctccagagccccgccctcagccaccgattcc
tccaatggactgaatgtctttatggctcagggcgagtttgacatgcctgggacagcttcc
actgtcaaggtagctgaaatgaaggtagggggtaaggtcctaagagagtctcacacagac
aaacagaatccgcaacagcaactctttgaaaactttgccatgttggaggagagtattgca
gatttgaatcgatccaacactctggggagctctgtgcttggacaccatgaccttttttct
tttaaaaatgaggacctctcatctatggataaggacatgcttgacacggggagagtcagc
tttgaacagtcgcagaaggacttggatctcagcgacaggttgctgggcgacaatacgatg
gacattctgcaggatctggacctccctggttctctgtctgacctgaatgagttttacgtt
gctgatgaggtcgccttcctgtcctctctgtcaggggatgatgccctgccaggggaaagc
aacgtagaaagcaagcctgtggttagcagcaatggggggaaacgtgccaatgtcaagttt
gtggagcagcaagagcttctggagcctgtaatcaagactgagatggatacggactcctcc
ttcatccaactttgcaccccgggtgtcatcaagcaggagagcgagagccgacgctattgt
caaatgccaaacttggacatgcctggtacccacagttcattgggcaccctgagtgggtcg
agttatcattacggagcaagcgcctcgagtgcagtgagtctacagcaagatcagaagcct
gtctttggcctgtatccccctctgtcctcggtcagtgatggctggaacccaggcactgga
cacagggatgggtcaggggtgtcgagcccttccgcctcatcttttcctgtcggttttagc
agttcaacagccagacctgaaggcagcacctccacagcgtcagcccctgccaagtccagt
ggtccgagccataagatctgcctggtgtgttcggacgaagcctctggctgccactatgga
gtcctcacctgtggaagctgcaaggtcttcttcaagagggctgttgaaggatggagagca
cgacaaaacacagatggacagcacaactatctttgtgctgggaggaacgactgcatcata
gacaaggtccgcagaaaaaactgcccggcctgccgattccgcaagtgtctccaagcaggg
atgaacctggaagcgaggaaaaacaagaagttaatacggttgaaaggccaacaggcctcc
ccggagacaagcctccctgcacctgatgaaagggcctttgccctcatcccaaagtcccta
ccccagctggtgcctaccatgctgtccctgctcaaagccattgagccagaggccatttac
tctggctacgacagcaccatcccagacacctctacccgccttatgaccacactcaacagg
ctaggagggcagcaggtcatatcagctgtcaagtgggctaagtccctaccagggttccgg
aaccttcacctggatgaccagatgaccctgcttcagtgctcctggctgttcctcatgtcg
tttggcctcggctggcgctcgtaccagcagtgtaacgggggcatgttgtgctttgccccg
gacctggtgattaatgatgagaggatgaagctgccctacatgaccgaccagtgtgagcag
atgctgaagatctccactgagttattgaggctgcacgtgtcctacgatgagttcctgtgt
atgaaagtcttgcttctactcagcacagtaccaaaggatggattgaagagccaggctgtg
tttgatgagatccgtatgacctacatcaaggagctaggaaaggccatcgtcaagcgggaa
gagaattccagccagaactggcataggttctaccagcttactaagcttttggactccatg
caagagatggttggaggcctcttgcagatctgcttctacacttttgtgaataagtccctg
agcgtggagttccctgacatgctggccgagatcatcagcaaccagctacctaaatttaaa
gacgggagtgtcaagccacttctgtttcataatgccttaaaccatgaccaaatgccttaa

DBGET integrated database retrieval system