KEGG   Esox lucius (northern pike): 105011240
Entry
105011240         CDS       T04894                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105011240
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105011240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:els04052]
    105011240
   00536 Glycosaminoglycan binding proteins [BR:els00536]
    105011240
Cytokines and growth factors [BR:els04052]
 Growth factors
  Growth factors (RTK binding)
   105011240
Glycosaminoglycan binding proteins [BR:els00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105011240
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 105011240
NCBI-ProteinID: XP_010869414
UniProt: A0A3P8Z7X6
LinkDB
AA seq 227 aa
MTLGGPWTTNTDRVTRTARTLTTEACLRRPRDSSTSHSTRSKQADMLAPLEHRCVAFSQP
RGHLAATSHPAKHCRMKEGDITLLALEPTIRPDYTHLRRLYCMNGGHHLQILPDGTVQGG
RDENKYDVLKVKAGGIGVVAIKSHEMGHYLAMNKEGHLYGSKNFTDECYFLEKMEENHYN
TYRSQKYQDKNWFLGLKRNGQPKAGPSTRIGQKAIYFLPRPVDSTAM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgacactgggcgggccctggactacaaatacagacagggtcacccggacggccaggaca
ctgaccaccgaggcgtgcctgagacgcccgagagactcatccacttcacactcaactaga
agcaagcaggcagacatgttggcccctctggagcaccgctgcgtggcgttctcacagcca
cgggggcatttagctgccacatcgcatccagctaaacactgtagaatgaaagagggggac
attactcttctcgctttggagccaacgatacggccggactacacacacctcagacggctc
tactgtatgaacggaggacatcacctgcagatcctaccagacggaactgtccaggggggc
agagatgaaaataaatatgatgtcctgaaggtgaaagctggggggatcggtgtggtggcc
attaagagccatgagatgggccattacctggcaatgaataaagaaggtcatctctacgga
tcaaaaaactttacagacgaatgttacttcctggagaagatggaggagaaccattacaac
acatacaggtctcagaagtaccaggataaaaactggttcctgggtctgaagaggaacggg
caacctaaagctggcccaagcacaaggataggacagaaggccatctattttctaccacgg
cctgtagacagcaccgccatgtga

DBGET integrated database retrieval system