KEGG   Esox lucius (northern pike): 105011392
Entry
105011392         CDS       T04894                                 

Definition
(RefSeq) cullin-3 isoform X1
  KO
K03869  cullin 3
Organism
els  Esox lucius (northern pike)
Pathway
els04120  Ubiquitin mediated proteolysis
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105011392
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105011392
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     105011392
DNA repair and recombination proteins [BR:els03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     105011392
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Phage_antitermQ
Other DBs
NCBI-GeneID: 105011392
NCBI-ProteinID: XP_010869682
LinkDB
AA seq 781 aa
MSNLSKGGTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNA
YTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRD
ILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRG
AIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARI
NEEIERVLHCLDKTTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYK
LFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESFN
NDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRF
MQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISN
TTMDEFRQHLQSTGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPSPRHAFEVFRRFYLA
KHSGRQLTLQHHMGSADLNATFYGPIKKRPSGDRLSPTLSAQEDGSEVVVGGAQVTGSNT
RKHILQVSTFQMTILMLFNNREKSMFEEIQQETDIPERELVRALQSLACGKPTQRVLTKE
PKSKEIENGHMFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAI
VRIMKSRKKMQHNVLVAEVTQQLRSRFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYV
A
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgtccaatctcagcaaaggaggcaccaagaaggacaccaagatgaggatacgagccttt
cctatgaccatggacgagaagtatgtcaacaacatctgggaccttctgaagaatgccatc
caggagatccagaggaagaacaacagcgggctgagcttcgaggagctctacaggaacgcc
tacaccatggtgctgcacaagcacggcgagaagctctacacgggcctccgggaagtggtc
acggagcacctcatcaataaagtaagggaagacgtactcaactccctaaacaacaacttc
cttcaaacactgaaccaggcctggaacgatcaccagacagcaatggtcatgatcagggat
atcctcatgtatatggaccgggtgtacgtgcagcagaacaacgtggagaatgtctacaac
ctgggcctcatcatcttcagggaccaggtggtgcgctacggctgcatccgggaccacctc
cgtcagaccttgctggacatgatcgcccgggagagaaagggcgaggtggtggacaggggg
gcaatcagaaatgcgtgccagatgttaatgattttaggcctcgaagggaggtcagtttac
gaagaagactttgaagccccgtttttagaaatgtccgcagagttcttccagatggaaagt
caaaagtttttagcggaaaacagcgccagtgtgtacataaagaaagtggaggcgcggatc
aacgaggagattgagcgcgtgctgcactgcctggacaagacgacggaagaacccatcgtc
aaggttgtggagcgggagctcatctccaagcacatgaagaccatcgtggagatggagaac
tctggcctggtccacatgctgaagaacggaaagacagaggacctggcgtgtatgtataag
ctctttagcagagtgccaaacgggctgaagaccatgtgtgagtgcatgagctcctatctc
cgtgagcagggcaaggctctggtgtctgaggagggtgagggcaaaaaccctgtggattac
atccagggtcttttggatctaaagtcacgttttgaccgcttcctccaggagtcgttcaac
aacgaccgtctgttcaagcagaccattgcaggggactttgagtacttcctcaacctcaac
tctcggtcgccagagtacctctcgctgttcattgatgacaagctgaagaagggcgttaaa
ggactgacggagcaggaggtggagtccatcctggacaaggccatggtgctgttccgtttc
atgcaggagaaggacgtgtttgagaggtactacaaacagcacctggcccggaggttgctc
accaacaagagtgtctcggacgactcggagaagaacatgatctccaagctcaagacggag
tgcggttgccagttcacctccaaactggaaggaatgttccgggacatgagcatctcaaac
acaaccatggatgagttcaggcaacacctgcagtcaacaggggtgtcgttgggtggagtt
gatcttactgtgagagtcttgacaactggttactggccaacgcagtccgccacacccaaa
tgtaatatccccccttcgcctcgacatgcattcgaagtcttcagaaggttttatctggcc
aagcacagtggaaggcagctcacgttgcagcatcacatgggctctgcagaccttaatgcc
accttctacggcccaatcaaaaagaggcccagtggtgaccgactctctccgactctctcc
gcccaggaggacggctcagaggtggtggtgggcggagcccaggtgacaggctccaacacc
agaaagcacatactgcaggtgtccaccttccagatgacaatactcatgctcttcaacaac
cgggagaagtccatgtttgaggagatccagcaggagacggacatcccggagagagagctg
gtacgagcgttgcagtcattggcctgtgggaagcccacccagcgtgtcctcactaaagag
cccaagtccaaggagatcgagaacggccacatgtttaccgtcaatgaccagttcacctcc
aagctgcaccgggtcaagatccagacagttgctgctaagcagggagagtcggacccagag
aggaaggagacacggcagaaggtggacgatgacaggaagcacgagatcgaggctgctatc
gtccgcatcatgaaatccaggaagaagatgcagcacaatgttttagtggcagaggtcacc
cagcagctgcgatcacgattcctccccagtcctgtagtcatcaaaaagcgaattgaagga
ctcattgagcgggaatatttggcgcggacaccagaggaccgcaaagtgtacacttatgta
gcataa

KEGG   Esox lucius (northern pike): 105024564
Entry
105024564         CDS       T04894                                 

Definition
(RefSeq) cullin-3
  KO
K03869  cullin 3
Organism
els  Esox lucius (northern pike)
Pathway
els04120  Ubiquitin mediated proteolysis
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105024564
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105024564
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     105024564
DNA repair and recombination proteins [BR:els03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     105024564
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Phage_antitermQ
Other DBs
NCBI-GeneID: 105024564
NCBI-ProteinID: XP_010892871
UniProt: A0A3P8ZX85
LinkDB
AA seq 766 aa
MSNLKGGVKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAY
TMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDI
LMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGA
IRNACQMLMILGLEGRSVYEEDFEGPFLEMSAEFFQMESQKFLAENSASVYIKKVEARIN
EEIERVLHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKL
FSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKTRFDRFLLESFNN
DRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRFM
QEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNT
TMDEFRQHLQSTGVSLGGVDLTVRVLTTGYWPTQSATPKCTIPPSPRHAFEVFRRFYLAK
HSGRQLTLQHHMGSADLNATFHGPIKKEDGSEVVVGGAQVTGSNTRKHILQVSTFQMTIL
MLFNNREKSTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFTVN
DQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVL
VAEVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgtccaacctcaaaggcggcgtcaagaaggacaccaagatgaggataagagcctttcct
atgacaatggatgagaagtatgtgaacaacatctgggacctcctgaagaatgccatccag
gagatccagaggaagaacaacagtgggctgagctttgaggagctctataggaacgcctac
accatggtgctgcacaagcacggtgaaaagctctacacaggcctgcgtgaggttgtcaca
gagcacctcatcaacaaagtacgggaagatgtcctcaactcgttaaacaataacttcctg
cagacattgaatcaagcgtggaacgatcaccagacagccatggtcatgatcagagacatc
ctcatgtacatggaccgggtgtacgtgcagcagaacaacgtggagaacgtctacaacctg
ggcctcatcatcttcagggaccaggtggtgcgctacggctgcatccgggaccacctccgc
cagaccctgctggacatgatcgcacgggagagaaaaggagaggtggtggaccggggagcc
atcagaaacgcctgtcagatgctgatgattctgggcttggagggccggtctgtgtacgag
gaggactttgagggccccttcttagaaatgtcagcagaattcttccagatggagagccag
aagttcctagcggagaacagtgctagtgtgtatataaagaaggtggaggccagaatcaat
gaggagatcgaacgggtgttgcactgcctggacaagtccacagaggagcccatcgtcaag
gtggtggagcgggagctcatctccaaacacatgaagaccattgtggagatggagaactct
ggcctggtccacatgctgaagaatggcaagactgaagacctgggctgcatgtacaaactg
ttcagccgtgtgcctaatggcctgaagaccatgtgtgagtgtatgagctcctacctcagg
gagcaaggcaaggctctggtgtcagaggagggagagggcaagaaccccgttgactacatc
cagggccttttggacctgaagacgcggtttgaccgtttcctcttggagtcgttcaacaat
gaccggctcttcaaacagaccatcgccggggactttgagtacttcctcaacctcaactca
cgttcccccgagtacctgtctctcttcatcgatgacaagctaaagaagggggtcaaaggg
ctgacggagcaggaggtggagtccatcctggacaaggccatggtgctgttccggttcatg
caggagaaggatgtgtttgagaggtactacaaacagcacctggcccggaggttgctcacc
aacaagagtgtctcggacgattcagagaagaacatgatctctaagcttaagacggagtgt
ggctgtcagttcacctctaaactggaagggatgttcagagacatgagcatctccaacacc
accatggatgagtttagacaacacttacagtccacgggggtctctctagggggtgttgat
ctcacagtaagagtactcaccacgggttactggcccacacagtcggccacgcccaaatgc
accattcccccctcccccagacacgcctttgaggtatttagaaggttctacttggccaaa
cacagtggcagacagttgacactccagcaccacatgggttcagctgacctcaacgccacc
tttcacgggcccatcaagaaggaggacggttctgaggtcgtagtgggaggagcccaagtg
acaggctctaataccagaaaacacatactgcaggtgtcaaccttccagatgacaatcctt
atgctcttcaacaacagagaaaagtccacgtttgaagagatccagcaggagacagacatc
ccggagcgggagctggtccgagcgttgcagtccctggcctgtgggaagcccacccagcgt
gtcctcaccaaggagcccaagtccaaggagattgagaacggccatgtgtttacagtcaat
gatcagtttacctccaaactgcaccgggtcaaaatacagacagttgctgctaaacagggg
gagtcggaccctgagaggaaggagacgcggcagaaggtggatgatgacaggaagcacgaa
atcgaagcagccatcgtccggattatgaagtccaggaagaagatgcagcacaacgtcctg
gtagcagaggttacccagcagctgcgggcccggttcctgcccagccctgtggttattaag
aagcgcattgaaggactaatagagagagaatacttggcacggacgccagaggaccgcaaa
gtctacacctacgttgcataa

DBGET integrated database retrieval system