KEGG   Esox lucius (northern pike): 105011534Help
Entry
105011534         CDS       T04894                                 

Gene name
polrmt
Definition
(RefSeq) DNA-directed RNA polymerase, mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:els03029]
    105011534 (polrmt)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     105011534 (polrmt)
Mitochondrial biogenesis [BR:els03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    105011534 (polrmt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_3 PPR_2 NST1
Motif
Other DBs
NCBI-GeneID: 105011534
NCBI-ProteinID: XP_012990574
LinkDB All DBs
AA seq 1342 aa AA seqDB search
MSLLRLCAFSKCLNGLILLERSVNRLSKARHCHHSFTFRNNSEMRISEPPWKSQQRHFSA
AFPKKEDGKKRLCEQSQLLDVLEARIQQLQSDVVLDVQHSKVQFVKAHKSERGASSGRNP
KINSGERTEVPTSGKIVGKVAGQTGKGKDDSPSKSRWLKKLNEEKTKTKKLKKKLGFEDI
PVKSKKGQQMLPGTSHKIISTKAVKKMASSSKKSMTLKNQVNTVAAANQEHTVAAKSSSA
SKVPVRNAKRNRETLKALYPELSEEEARTQELARLERKAEADALELAKVEELERKLKQWA
VSVSPEHVKDNGEARAYEDVQRRVHCYLEACVFSGDIDRAGHFLLSHHRRVSRRKLLNIE
SYNIMMRVWAKMGSLKQIGRMFILVEEAGLKPNLSSYCAALECMGRTPNCPPRFINRVLQ
QIQWDGLSVDELFRHCVFRQDERDMVLKAIHTLKPDFQPSIKPILHTCSSPLVKDIYTER
TDSKYPKLAFSLDELQKRFNNQLCLEQASTITINSVEALKPVTPHMVKMRDLLAEQRKVW
HKTLVKALRESKAIMASSTQKVVRFSLYPYLCLMDEKEYADIMIQSLANLPPSGESLHIL
AKQLGVRVHNKFCILMKEQNQMVDKLNNIYNEYVELLSKDNKVLNVLPREQWQTLEAKHM
SGPSLLGDECHWPHAVVLELGTYLVDLMVKHMKVNSDILNSAYNRKIIPVLYHMYTFRSN
RQVGFIKPHPILTQIQQDAMETTLTFDSYVMPMLCPPVPWASAKFGAYLLTPTKLMRAVL
GANQHEIQLEKCQEEELHPVLDSLTQLGNTAWRINQPLLDVIISIFNGKGSEKLDVPPPL
SEAPRIPRYNQQELATYTSAEKAQLKREVINAKKKCGEMHSLRMDALYKLSIANHMRDEV
FWFPHNMDFRGRTYPCPPYFNHLGSDVTRAVLVFAEGKALGPGGLDWLKIHLVNLTGLKK
RSSLAGRLEYANTIMDDIMDSADNPLNGKKWWQNADEPWQALACCMEITNAIRSPDPTQF
ISHFPVHQDGSCNGLQHYAALGRDVIGATSVNLMPCDVPQDVYSVVAQQVEGFRVRDAEK
ALKVAQVLEGFINRKVVKQTVMTVVYGVTRYGGRLQIEKRLKEIDNFPKEYVWDASHYLV
QQVFTSLKEMFTGTREIQDWLTESARLISKSGHTVEWVTPLGLPVIQPYHRPRTQLLKNQ
IQDLSLQISHDSKQRPDTVKQKNAFPPNFIHSLDSTHMMLTALYCYSAGLTFVSVHDCFW
THAITVDTMNKVCREQFVALHSQPILQELSNFLLQKYCSVPPNEVNNKKIQEYRRMLLLL
AKVPQTGDFDLQQVKESTYFFS
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttttgagactgtgtgccttttcaaaatgtctaaatggtttgatcctgttggaa
agaagtgttaatcgtttgtcaaaggctcgccattgtcatcattcttttactttccggaat
aattctgaaatgcgaatatcagaaccaccatggaaatcacaacaaagacatttctcagct
gcgttcccgaagaaagaagatgggaaaaaacggttatgtgaacagtctcagctgctggat
gtgcttgaagccaggatccagcaacttcaatctgatgttgttttagatgtccaacattca
aaggttcaatttgtcaaagctcataaatcagagagaggggcttcctcaggaaggaatccc
aaaataaattctggggagaggactgaggtacccacctcaggaaagattgttggtaaggta
gcgggacagactggtaagggcaaagatgactccccctccaaatcccgctggttgaagaaa
ctcaatgaggagaagaccaaaacaaagaagctaaagaagaagctgggctttgaagatatt
cctgtgaaaagcaagaaaggccaacagatgctcccaggtacctcacataaaattatatcc
actaaagcggtaaaaaagatggcatcaagttctaaaaaaagcatgactctaaaaaaccaa
gtgaatactgtggcagctgcaaaccaagaacacaccgttgcagctaaatccagttctgcc
tctaaggtgccagttagaaatgccaaacggaacagggaaaccctgaaggcgctgtatcct
gagctgtcggaggaggaggccaggacccaggagctagccaggttagagcggaaggcagag
gcagacgcccttgaactggctaaggttgaagaattagagaggaagctgaaacagtgggct
gtctcagtcagtccggagcacgtgaaggataacggcgaggccagggcgtatgaggacgtc
cagcgaagggtgcactgctacctggaggcctgtgtgttcagtggggatattgaccgagct
ggccacttcctgctcagccaccaccgaagggttagccgacgcaagctgctcaacatagaa
tcctacaacatcatgatgagggtctgggcaaagatgggatcattgaagcagattgggcga
atgttcattctagttgaagaggctggtctcaaacccaatctcagctcctattgtgcagct
ctggagtgtatgggccgaacccctaactgtcccccacgtttcatcaacagagtcctgcag
cagattcagtgggatggactgtctgtggatgagctgttccgtcactgtgtcttcagacag
gatgagagggacatggtgcttaaggccatccacactttgaaaccagacttccagcccagc
atcaaacctatcttacacacctgctcctcaccactggtcaaggacatctacactgagaga
acagattctaagtaccccaagctggccttcagcctggatgagctgcagaagaggttcaac
aatcaactttgtctggagcaggccagcaccatcactatcaactctgtggaggccctgaag
cctgtcaccccacacatggtcaaaatgagggatctgctagcggagcagcggaaagtgtgg
cacaaaaccctggtcaaggcactgcgggagagcaaagccatcatggctagcagcacccag
aaggtggtcaggttcagcctctacccctacctgtgcctgatggacgagaaggagtacgca
gacatcatgatccagagtctggccaacctgcctcccagtggagagtcgctccacatcctg
gccaagcagttgggtgttcgggtccacaacaagttctgcatcctgatgaaggaacaaaac
cagatggtggacaagctgaacaatatctacaatgaatatgttgagctactgtccaaagac
aataaggtgttgaacgtactgcctagggagcagtggcagacgctggaggcgaagcatatg
tcaggcccctccctgctgggagacgagtgccactggccccacgcggtggtgttggagctg
gggacctacctggtggacctcatggttaagcacatgaaggtgaacagcgacatcctcaac
tctgcctacaaccggaagatcatccctgtgctctaccatatgtacaccttccgcagtaac
agacaggtgggctttatcaagccacatcccatcctgacacagatccagcaggacgccatg
gagaccacattgacctttgactcctacgtaatgccaatgctgtgccctcctgtcccctgg
gcctcagccaagttcggcgcttaccttctcacgcccaccaagttgatgcgtgccgtgctt
ggcgccaaccagcacgagatccagctggagaaatgtcaggaggaggagctccatccggtg
ctggactccctcacccagctgggcaacaccgcctggaggatcaaccagcccctgctggac
gtcatcatatccatcttcaacggtaagggcagcgagaagcttgacgtcccgcctcccctc
tcggaggcccccaggatccctcgctacaaccagcaggaattggccacctacacctcggct
gagaaggcccagctaaagagagaggttatcaacgccaagaagaagtgcggggagatgcac
agcctcaggatggacgccctctacaagctgtccatcgccaaccacatgagagacgaggtc
ttctggttcccacacaacatggactttcgagggcgcacatatccgtgcccgccctacttc
aaccacctgggcagtgacgtgaccagggccgtcctggtgtttgcagaggggaaagccctg
ggacctggtggcctggattggctgaagatccacctggtcaaccttacagggctgaagaaa
cgcagctcgctggccggcaggctggagtacgccaacaccatcatggatgacattatggac
tccgcagacaaccccctcaacggtaagaagtggtggcagaatgcagatgaaccgtggcaa
gccctggcctgctgcatggaaatcacaaacgctatcagatcacctgaccccacacagttc
atctcccacttccctgtacatcaggatggttcgtgtaatggactccagcactatgcagct
ctgggtcgggacgtgatcggtgccacctctgtgaacctcatgccgtgcgatgtgccccag
gatgtatacagcgtcgtggcacagcaggtggagggctttcgtgtgcgggatgcagagaag
gctctgaaggtggcccaggtgcttgagggcttcatcaacaggaaggtggtgaagcagact
gtgatgacggtggtgtacggcgtgacgcgttacggaggacgcctccagatagagaagagg
ctcaaggagatcgataactttcctaaggagtacgtatgggacgcctctcactacctggtc
cagcaggtgttcaccagtctgaaggagatgttcacaggcaccagagagatccaggactgg
ctgacggagagtgccagactcatctctaagtctggccacacagttgagtgggtgacaccc
ctggggctgcccgtcatccagccctaccaccgcccccggacacagttgctgaagaaccaa
atacaggacctgagtcttcagatctcccacgattctaaacagaggccagacactgtaaaa
cagaagaatgccttccctccgaacttcatccactctctggactccacccatatgatgctg
actgctctctactgctacagcgccggtctcacattcgtctctgtccacgactgcttctgg
acccacgccattacagtcgacactatgaacaaggtttgccgggagcagtttgtggcactg
cacagccaacctatccttcaagagctgtccaacttcctactgcagaaatactgctctgta
ccaccgaacgaggtcaacaacaagaagattcaggagtaccggaggatgttgttgttgctg
gccaaagtgccccaaacgggcgactttgatctccagcaggtgaaggaatcgacgtacttc
ttcagctga

DBGET integrated database retrieval system