KEGG   Esox lucius (northern pike): 105011836
Entry
105011836         CDS       T04894                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04020  Calcium signaling pathway
els04144  Endocytosis
els04510  Focal adhesion
els04540  Gap junction
els04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105011836 (pdgfra)
   04020 Calcium signaling pathway
    105011836 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105011836 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105011836 (pdgfra)
   04540 Gap junction
    105011836 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105011836 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105011836 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:els04090]
    105011836 (pdgfra)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105011836 (pdgfra)
Protein kinases [BR:els01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   105011836 (pdgfra)
CD molecules [BR:els04090]
 Proteins
  105011836 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 105011836
NCBI-ProteinID: XP_010870533
UniProt: A0A3P8XJ92
LinkDB
AA seq 1375 aa
MDDARTCLILGIILCGIISVTCGRTPPAIVSTEDTFFVKPHSMFNISCTGKMQVIWVEPL
PDNAFVMPGYYTATLFIYNASVANTGHYTCKYEGDEDDNEENMASIYIFVPEIEDFNVEV
KASEEAVRLGESFNITCVAPLGLPYQQQWLHPRKQAVDAVQMKQTMPDRVVYILSFPAAS
SQDSGVYECSIANNFTGEIRANRVSVTVFGESSFVKLDHRGIGAVEFVSVMEETEFNIFM
EAFPAPKVTWLKDGIAVTENSYLLTKTSHLEGSRYQGTLTLRQPLEKDSGNYTVVVLSSP
HVAQFSFTLKVKASGLDMFQPASAPVLFPQEEEMVVPLHTPFTLICRGEAELAWDTPVYL
PEQREEDNSGLFVTTVTVDNATAAHTGLYSCYYNSGNSTEEGDESSIYVYVPDPEVPFVP
SPLVFNNHVLSGHDEMEIQCRVSDPAANVTLINADTQQPVPITAYNSKRGAVGFFNAGTY
VCVAVIDGEEHFSEEYIVHGWVAGMDLRVELKAQKTALLVGDTITVTCVARGSEILDDHW
KYPGKLANRGSKAVRENKRDQEIEYTLTIPRATAKDSGVYACSITDIISNESQTKELTIN
VYERPFVSLHPRFTSQESAELDEVKDFQAEIDSFPSAQVTWLKDGLPLNDVAAEIITTIQ
QVSETRYQSVLTLIRAKEEDCGNYTIRVHNGNQTRSHTFSLQVKVPAVIVNLMDLHQGSV
SGQSVVCIAGGMPTPQVDWFICKNIKLCANDSSQWLPLPTNNTEITVETHIDQDNLLESQ
VIFGRLDNTLAVRCLARNEMATVSREVKLVSAGHRSELTVAAAVLVLLVIVIISLIVLVI
IWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWEFSRDGLVLGRILGSGAFGKV
VEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKS
GPTYIITEYCFYGDLVNYLHKNRENFLNLHPEKTKKDLDIFGINPADESSRSYVILSFEA
GRGDYMDMKQADTMQYVPMLEMSDASKYSDIQRTEYDHPPSQKGENEMDSLLSDDGSEGL
STLDLLSFTYQVARGMEFLSSKNCVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYV
SKGSTFLPVKWMAPESIFDNMYTSLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIK
SGYRMAKPEHAPADLYDMMMKCWNSEPEKRPSFYSLSESVVSLLPSGYKRCFERVNHEFL
KSDHPAVTRVQVESDDAYIGITYKNQGKSKDRESGFDEQRLSSDSGYIIPLPDLDPLSDD
EYGKRNRHSSQTSEESAIETGSSSTLTKREGETLEDITLLDEMCLDSELVEDSFL
NT seq 4128 nt   +upstreamnt  +downstreamnt
atggatgatgcaaggacatgtctcatccttgggattattttatgcgggattatatcagtt
acctgtggacggacgccaccagcaattgtatcaactgaagatacgttttttgtcaagcca
cattccatgttcaacatcagctgtactggcaaaatgcaagttatctgggtcgagcccctg
ccggacaacgcattcgttatgcctggatactacacagccacgctcttcatctacaacgct
tccgtggcaaacaccggacattacacctgcaaatatgaaggcgatgaagatgataatgag
gaaaatatggcgtcaatatacatttttgtcccagagattgaggacttcaatgtagaggtg
aaggccagcgaggaggcagtgagacttggggagtccttcaacatcacctgtgtagctcct
ctaggactgccctaccagcagcagtggctccaccccaggaaacaggctgtggatgccgtc
cagatgaagcagaccatgcctgacagagtggtttacatactcagtttcccagcagcctcc
tctcaggacagtggggtgtatgagtgctccatcgccaataacttcactggagagatcaga
gccaaccgggtgtcggtcactgtttttggggagagctcctttgttaagttagaccacagg
gggatcggagcagtggagtttgtcagtgtgatggaggagacagagttcaacatttttatg
gaagcattccctgcccctaaagtcacctggctgaaagatggtatcgccgtcaccgagaac
agctacctactcactaagaccagccacctggagggcagccggtatcagggcactctgact
cttcggcagcccctagagaaggacagtggtaactacaccgttgttgtcctgagcagccct
cacgtagcccagttctccttcaccctcaaagtgaaagcctcaggtctggacatgttccag
cctgcttcggccccggtgttgttcccccaggaagaggagatggttgtgccccttcacacc
cccttcaccttgatctgccggggcgaggccgagctggcctgggacacacccgtctaccta
cccgaacagagggaggaggacaacagcggcctgttcgtcaccacggttaccgtggataac
gccacagcagcccacacgggcctttacagctgctactacaacagcggaaactctaccgag
gagggcgatgaaagcagcatctatgtctatgtgccagatccagaggtgcctttcgtgccc
tccccgctggtgttcaacaatcacgtcctgagcggccacgacgagatggagatccagtgc
cgtgtgtcggaccccgccgccaacgtaaccctgatcaacgccgacacccagcagcccgtg
ccaataaccgcttacaacagcaagaggggcgcggtggggttcttcaacgcgggaacctac
gtgtgcgtggccgtcatcgacggcgaggagcacttcagcgaggagtacattgttcacggc
tgggtggcgggaatggacctgcgtgtggagctgaaggcccagaagactgccctcctggtg
ggggacaccatcactgtgacctgtgtggctcgaggctctgagatcctggatgaccactgg
aagtaccctgggaaactggccaaccgtggctccaaggcggtgcgggagaacaagagggac
caggagattgagtacaccctgaccatcccccgagccacggccaaagacagtggcgtctac
gcctgctctatcactgacatcatcagcaacgaaagccagaccaaggagctgaccatcaat
gtctatgagaggccattcgtgtcactgcatccaaggttcacctcccaggagtcagcagag
ctggatgaggtcaaagatttccaagctgaaattgactccttccccagcgcccaggtcaca
tggctcaaagatggcctccccctcaacgacgtggctgctgagataatcaccaccatccag
caggttagcgagaccaggtaccagagtgttctgaccctgatccgggccaaggaggaggac
tgtggaaactacaccatccgagtgcacaatggaaaccagacgcgcagtcacacctttagc
ctacaggtcaaagtgcctgcagtcattgtgaacctgatggacctccaccaaggctcagtc
tctggtcagtccgtagtgtgtattgctgggggcatgcccactcctcaggtggactggttt
atctgcaagaacatcaaactctgtgccaacgattcatctcagtggttgcccctgccaacc
aacaacacagagatcaccgtggagacgcacattgaccaagacaacctgctggagagtcag
gtgatcttcgggcggctggataacaccctggctgtccgctgcctggccagaaacgagatg
gccaccgtcagcagggaagtcaagctggtgtcagcaggccatcgctctgagctgaccgta
gccgccgctgtcctggtactgctggtcattgtcatcatctcactcattgtcctcgtcatt
atctggaaacagaagcctcgctatgagatccgttggagagtgatcgagtcggtgagccct
gacggtcatgagtacatctacgtggaccccatgcagctgccctacgactccagatgggag
ttctcccgcgatggcctcgtcctgggtcgtatcctaggctctggggcctttgggaaggtg
gtggagggaactgcatacggactcagccgctcccagcccgtcatgaaggtggctgtgaag
atgctcaaacccacagcccgttccagtgaaaaacaggccctgatgtcagagctgaagatc
atgactcatctgggccctcatctcaacatcgtcaacctgctgggggcctgcactaagtca
ggccccacctacatcatcactgagtactgtttctatggagacctggtcaactatctgcac
aagaacagagagaacttcctcaacctgcacccggagaagaccaagaaagacctagatatc
tttggcatcaaccctgcagacgagagcagcaggagctacgtgatcctgtccttcgaggct
ggccgaggggactacatggacatgaagcaggcagacaccatgcagtacgtacccatgctg
gagatgagtgacgcctccaagtactctgacatccagaggactgaatatgaccacccgcca
tcacagaagggggagaacgagatggacagcctcctgtcagatgacggaagcgagggcctc
agcaccttagaccttctcagctttacctaccaggtggccagaggcatggagttcctatcc
tctaagaactgtgtgcatcgggacctggcagccaggaacgtccttctatctcaggggaag
atagttaagatctgtgacttcggcctggccagagacatcatgcatgacaataactacgtc
tccaaaggcagtaccttcctgcctgtgaaatggatggctcctgagagtatctttgacaac
atgtacacctccctcagtgatgtctggtcctacggcatcctcctctgggagatcttctct
ctaggtgggactccatatccaggaatggtggtggactccagcttctacaacaagatcaag
agtggttacaggatggccaaaccagagcacgccccggctgatttgtatgacatgatgatg
aaatgctggaacagtgagcctgagaagaggccctccttttacagcttgagtgagagcgtt
gtgtccctgctgccctccggctacaagaggtgctttgaaagggtgaaccatgagtttctg
aagagtgaccacccggccgtgaccagggtccaggtggagagtgacgatgcctacattggg
atcacctataagaaccagggcaagtccaaggacagggagagtggcttcgacgagcagcgc
ctcagctctgacagcggttacatcatcccgctccccgacctggaccctttgtctgacgac
gagtacggcaagaggaaccgccacagctcccagacatccgaggagagtgccatagagaca
ggctccagttccacactgaccaagagggaaggagagaccctggaggacatcaccttattg
gatgaaatgtgtctggactcagagctggtggaggatagctttctgtga

DBGET integrated database retrieval system