KEGG   Esox lucius (northern pike): 105012341Help
Entry
105012341         CDS       T04894                                 

Definition
(RefSeq) transmembrane protease serine 4 isoform X1
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:els01002]
    105012341
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     105012341
Peptidases [BR:els01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   105012341
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2 SecE
Motif
Other DBs
NCBI-GeneID: 105012341
NCBI-ProteinID: XP_010871419
LinkDB All DBs
AA seq 484 aa AA seqDB search
MNTIPNHQSLTLVLRLKDRQTPATVSSDTDNQVDESNRPLNPPKQVSARPGRHRKPMTAT
KAQTKKSPPTKKSILLTVLVVLVVLGILVTCGYFIKLLIDSKYFFCYRSVKFIPLDEACN
GKADCSGGEDELSCVTNLTVSTIFPVRLVSESNVFQVYSAGTGWRSVCSEGWTQQHTLKA
CQKLGYTNKPKSSNTSVLSLPSSLKTGPFAIVTSSAVTTPINQTVADTPGCSSGTVVSLS
CSECGERGPTDRIVGGTDTTIEDWPWQVSLQLNGQHTCGGTLLSPRWVVTAAHCFSGKKL
LSRWSVVSGITYMTVLGGSSVDMVIVNGKYDAARNDFDMAMMRLTTPVSLADYRRPVCLP
PKNLGLKAGASLTVTGWGYLEEKGKVSTILQKANIPLIGQDQCSSPIVYADSITPRMLCA
GYLEGKVDACQGDSGGPLVYQSERWMLVGVVSWGIGCARHNLPGVYCNVDEMLNWIYNVM
DENP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatccccaaccaccagagcctgacattagtactgaggctaaaggaccgacag
acaccagcaacagtttcatcggatactgacaatcaggttgatgaaagcaacaggccatta
aatccaccaaaacaagtttcggcgcggcctggcagacacagaaagccaatgacggctacc
aaggcccagactaagaagtcgccgccgactaagaagagcatcctgctgaccgtgttggtg
gtgttggttgtgctggggatcctggtgacttgtggatacttcatcaagctgctgatagac
agtaagtatttcttctgctaccggtcggtgaagtttattcctctggatgaagcgtgcaac
gggaaggcagactgctcaggaggagaggatgaactctcatgtgtgaccaacctgacggtc
agcaccatcttcccagtgcgcctggtctctgagagcaatgttttccaggtctacagtgct
gggacaggctggagatctgtgtgtagtgagggctggactcaacagcacacactcaaagcc
tgtcagaagctgggctacaccaataagccaaagagtagcaacacgtcggtgctgagcctg
ccctcgtcgctgaagaccggaccgttcgccattgtcacttcatcggctgtaaccactccc
attaaccagacggtcgctgacaccccagggtgtagttcaggaaccgtggtctccctgtcc
tgctcagagtgtggagagcgggggccaacagaccgtattgtgggggggacggataccact
atagaggactggccgtggcaggtgagcctgcagctgaacggacaacacacctgcggaggc
acactgttgtccccgcgctgggtcgtcacggcagcacactgcttctctggcaagaaattg
ctgagtcgctggagtgtggtgtctgggattacctacatgactgtcctggggggctcatct
gtggacatggtcatagtgaacggaaaatatgatgctgccagaaatgacttcgacatggcc
atgatgagactcaccacacccgtctctctggcagactaccgtcggcctgtgtgcctgcct
cctaagaacctgggactgaaggcaggagcctctctgacggtcacaggatggggttacttg
gaggagaaaggtaaggtgtccactatcctgcagaaagccaacattcccctgataggccag
gatcagtgctcgagtcccattgtctacgcagactccattactcccaggatgctttgcgca
ggttacctggaaggcaaagttgatgcatgccagggagacagcggcggtcctctcgtctac
cagtcagagcgctggatgctggtgggggtcgtgagttggggtattggctgtgccagacat
aatcttccgggggtctactgcaacgtggacgagatgctcaattggatttataacgtcatg
gacgaaaacccatga

DBGET integrated database retrieval system