KEGG   Esox lucius (northern pike): 105012998
Entry
105012998         CDS       T04894                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105012998
   04340 Hedgehog signaling pathway
    105012998
   04068 FoxO signaling pathway
    105012998
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105012998
   04115 p53 signaling pathway
    105012998
   04218 Cellular senescence
    105012998
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105012998
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 105012998
NCBI-ProteinID: XP_010872518
UniProt: A0A3P8YUD2
LinkDB
AA seq 313 aa
MSVLVSLWCEEEVRGQQGEGDQVRVQPQLRAPWDPSVSGKRVIQRLLQVEERYLPSALYV
ALIQSEPERREELAKWAMEVCCECGCDETVFPLSVSLLDRFLSACLSLPVSPYCLAAACI
LISSKLSECDTVSADSLCAAAEYSFLPSNIREMERLVLATLRWDMAAVTPQDFLPHFLPR
VGEQKDGETNTEEYFSTLRRHSDTLVAMCVCDYRFLGAPPSLVAAAALNSALRGLGNKGP
GHLGHMSATLAELCQTDLRVLQCYSDLIEAALKQRLRGGLRDSALEKGGEMEKGGEMEDE
RASTPTDMREIDF
NT seq 942 nt   +upstreamnt  +downstreamnt
atgtctgtgttagtgtctctgtggtgtgaggaggaggtccgaggccagcagggtgagggg
gaccaggtcagggtccagccacagctccgcgccccctgggaccccagcgtgtctgggaag
cgggtcatccagaggctgcttcaggtggaggagcgatatctgccctccgccctctatgtc
gccctcatccagagtgagccagagcgaagagaggagcttgccaagtgggctatggaggta
tgctgtgagtgtggctgcgacgagaccgtgtttcccctgtccgtctcattgctggaccgc
ttcctgtctgcctgcctctccctgcctgtctcaccgtactgcctggccgcggcctgcatc
ctcatttcttccaaactaagcgaatgtgacacggtctcagctgacagtctctgtgctgcc
gccgagtacagcttcctgccctccaacatacgggagatggaacggctcgtcctcgccact
cttcgatgggacatggcagcagtaacccctcaggacttcctaccacattttcttccccgc
gttggagagcagaaggacggagagaccaacacagaggagtacttctccacactgcgtcgt
cacagtgacaccctggtcgctatgtgcgtctgcgactaccgtttcctgggagcccctcca
tctttggtcgcggcggcggcactgaactctgccctccgagggttgggcaacaagggccca
ggtcatctgggtcatatgagtgcaacgttggcagagctgtgtcagactgacctgagggtg
ttgcagtgctacagtgacctgatagaagctgccctcaaacagcggctgagagggggactc
cgagacagcgccttggagaagggcggagaaatggagaaaggtggagaaatggaggacgaa
agagcaagcacacctaccgatatgagagagattgatttctaa

KEGG   Esox lucius (northern pike): 105017123
Entry
105017123         CDS       T04894                                 

Gene name
ccnd3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
els  Esox lucius (northern pike)
Pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105017123 (ccnd3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105017123 (ccnd3)
   04115 p53 signaling pathway
    105017123 (ccnd3)
   04218 Cellular senescence
    105017123 (ccnd3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105017123 (ccnd3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105017123
NCBI-ProteinID: XP_010879785
UniProt: A0A3P8YBW7
LinkDB
AA seq 305 aa
MELLCHEDGEFQTSESTTEYMGSTALRASSDPTLTRDHRTLQNLLAVEKTIRASPSYFGS
IQTDIQTYMRRILAVWMLQVCEEQKCEEEVFPLAIHYLDRYLSHFPVQRSNLQLLGAVCM
FLASKLRETVPLSARKLCIYTDNAVTVSELLQWELMVVAGLDWDLASVVPSDFLEPILHG
IPIVPHNIHALRRHVHSYIALAATEYKFSVFLPSTIACASVGAAIRRLDLLDGALSNDSL
LQLLANILAIDLESLCCCSDLLEGMLELSLPPCHQAPGAYRSVTPGPDVSYTPTDIQDVH
LSPQR
NT seq 918 nt   +upstreamnt  +downstreamnt
atggagttgttgtgtcatgaagatggagaattccaaacatcagaaagcactaccgaatat
atgggttccactgctcttagggccagttctgatccgacattgacacgggatcatcgaaca
ttgcagaatcttcttgctgtggaaaaaacaattcgggcctcaccgtcgtactttggctca
attcagacagacattcaaacatatatgcggagaatattggcagtatggatgctacaggtt
tgcgaggagcagaagtgtgaggaggaggtgtttccgttggccatccattacctcgaccgt
tacttgagtcactttcctgttcaaagatccaacttgcagcttttaggtgctgtttgcatg
ttcctggcttcaaaactgcgagagactgtacccctgagtgcccgcaagctctgcatctac
accgacaatgccgttacagtgtcagaacttctgcagtgggaacttatggtggtggcaggg
ttagactgggacctggcttctgttgtaccctctgattttctggagccaattcttcatggc
atacccatagttcctcacaacatccatgccctgcgcaggcatgtgcattcctatattgca
ctggcagccacagagtataagttttcagtgttcctgccctctaccattgcctgcgccagc
gtgggtgctgccattcgcagactggacctcctggatggagctctatccaacgattcactc
ctgcagctactagccaacatcttggccattgatttggagtctctctgctgctgctctgac
ctgttggagggcatgttggagctcagcctacccccctgccaccaggcaccaggggcttat
cgctctgtgacccccggaccagatgtcagctacacccccactgacatccaggacgtacac
ctttcaccacagcgctag

KEGG   Esox lucius (northern pike): 105017289
Entry
105017289         CDS       T04894                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1 isoform X1
  KO
K04503  G1/S-specific cyclin-D1
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04530  Tight junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105017289 (ccnd1)
   04340 Hedgehog signaling pathway
    105017289 (ccnd1)
   04371 Apelin signaling pathway
    105017289 (ccnd1)
   04068 FoxO signaling pathway
    105017289 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105017289 (ccnd1)
   04115 p53 signaling pathway
    105017289 (ccnd1)
   04218 Cellular senescence
    105017289 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105017289 (ccnd1)
   04530 Tight junction
    105017289 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105017289
NCBI-ProteinID: XP_010880072
UniProt: A0A3P8Z0L9
LinkDB
AA seq 292 aa
MENQLLCCEVETIRRAYHDTNLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEHTKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSIRPSDLLQMELLALNKLKWDLASVTPHDFIDHFLSKLPIHQNTKQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLYLKSTDGALSSENLTNFLSQVIKSD
PDCLRSCQEQIESLLESSLRQAQQQIVSTETKRIDEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaaaaccagctgttgtgctgtgaagtggagaccatcagaagagcttaccatgatacc
aacttactaaatgaccgagttctacagacaatgcttaaagctgaggaaaattaccttccg
tctccaaattacttcaagtgtgtccagaaagaaataatacctaagatgaggaaaatagtg
gctacatggatgttagaggtctgcgaggaacagaaatgcgaggaggaagtttttcccctg
gctatgaactacttggatagatttttgtctgtggagcacacaaagaaaaccagattacaa
cttctcggagctacatgtatgtttctggcctcaaagatgaaggaaacggtccctttaact
gcagagaagttgtgcatttacactgacaactccatccggcccagcgatcttttgcaaatg
gaactactggctttaaacaagttgaaatgggaccttgcatcagtaacacctcacgatttc
atagaccatttcctctccaagctaccaattcatcagaacaccaagcagatcctgcgcaag
catgcccaaacatttgtggctctctgtgctacagatgtcaagttcatcgccaaccctcca
tccatgatcgcagcaggcagcgtggcagcggcggtccaggggctgtatctaaagagcaca
gatggtgcgctgtcatccgagaacctaaccaacttcctgtcccaagttatcaagagtgac
ccggattgcctgaggtcgtgtcaggaacagatcgagtccctgctggagtctagtttgaga
caggcacagcaacaaatcgtctccacagaaacgaaaaggatagatgaggaggtggacctt
tcctgcacccccacagatgtgagggacgtcaacatttga

KEGG   Esox lucius (northern pike): 105018224
Entry
105018224         CDS       T04894                                 

Gene name
ccnd2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105018224 (ccnd2)
   04340 Hedgehog signaling pathway
    105018224 (ccnd2)
   04068 FoxO signaling pathway
    105018224 (ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105018224 (ccnd2)
   04115 p53 signaling pathway
    105018224 (ccnd2)
   04218 Cellular senescence
    105018224 (ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105018224 (ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin K-cyclin_vir_C
Other DBs
NCBI-GeneID: 105018224
NCBI-ProteinID: NP_001297874
UniProt: C1BZ76
LinkDB
AA seq 300 aa
MELLCLERDTVIRACPDPNLLCNDRVLQSLLNIEERFIPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVFPTKKCYLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLDWELVVLGKLKWNLAAVTPNDFIEHIVRKLPLPEEKLVLIRKH
VQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDSGDQSQWGDSLTDLLAKITNTEV
DCLKECQEQIERVLVSSLREGRQQHHQQQQVQHGPSSKTVEEQDQSTAPTDVRDINIYPE
NT seq 903 nt   +upstreamnt  +downstreamnt
atggagctgctttgccttgaaagggacacagtcataagggcttgtcctgatccgaatctt
ctgtgcaatgacagggtattgcaaagcctgctgaacattgaagaaagatttattcctcaa
tgttcttatttcaagtgcgttcaaaaagatattcagccgtttatgaggaggatggttgcg
acttggatgctggaggtttgtgaagaacagaagtgtgaggaagaggtttttcccttggct
atgaactacttggacagatttttagccgtgtttccaaccaaaaagtgttatctgcaactt
ctcggggcagtttgcatgttccttgcatccaaattgaaagaaacccgtccattaactgca
gaaaaactctgcatctacacagataactccatcagaccacaggagctgctggattgggag
ctggtggttcttgggaagttgaagtggaacctggcagctgtcaccccgaatgacttcatt
gagcacattgtgaggaagcttccgctgcccgaggagaagctggtgctgatacgcaaacac
gtgcagaccttcatcgcactctgtgccacagatttcaactttgccatgtaccctccatcc
atgatcgccacgggcagtgtgggagcagctatctgcggcctccagttggactcgggtgac
cagtcgcagtggggggacagtctcacggacctactggccaaaatcactaacacagaagta
gactgtttgaaggagtgccaggagcagatcgagagggtcttggtgagcagcctgcgtgag
ggacgtcagcagcaccaccagcagcagcaggtccagcacggtcccagcagcaagactgtg
gaggagcaggatcagtccaccgccccaacagacgtccgcgacatcaacatctacccggaa
taa

KEGG   Esox lucius (northern pike): 105018279
Entry
105018279         CDS       T04894                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04530  Tight junction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105018279
   04340 Hedgehog signaling pathway
    105018279
   04371 Apelin signaling pathway
    105018279
   04068 FoxO signaling pathway
    105018279
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105018279
   04115 p53 signaling pathway
    105018279
   04218 Cellular senescence
    105018279
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105018279
   04530 Tight junction
    105018279
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105018279
NCBI-ProteinID: XP_010881878
UniProt: A0A3P8Y047
LinkDB
AA seq 374 aa
MQFIQRCLPLICSVTTVTSLPQFAEGRGVNTVGPSLVTLLRASTQQMRQTETEKHILNYW
RSIHSLTLLGSFIAQATDEAEGMEHQLLCCEVETVRRAYQDTNLLNDRVLQTMLKAEDNY
LPATNYFKCVQKEIVPYMRRIVSTWMLEVCEEQKCEEEVFPLAMNFLDRYLSIEPTRKTR
LQLLGATCMFLASKMKETIPLTAEKLSIYTDNSIRPGELLQMELLVLNKLKWDLASVTPH
DFIDHFLSKLPIHPDTKQILRKHAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLHLK
SADNALSSQQLTDFLSQVIRSDPDCLRACQEQIESLLETSLRQAQRHTVSTETKNVDEEL
DLSCTPTDVRDVNI
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgcaattcattcaaaggtgcttgcctttgatctgctcagtaacaacagtcacgtcattg
ccccagttcgccgaggggaggggagttaatacagtagggccgagtttggtaaccctcctg
agagcttcgacacagcagatgcgtcagacagagacagagaaacacatactgaactattgg
agaagcattcattcactcactcttttaggctcttttattgctcaagcgactgacgaagct
gaaggaatggaacatcagttgctgtgctgtgaagtggagaccgtccggagagcttaccaa
gacacaaacctgcttaacgacagagttttgcagaccatgcttaaagctgaagacaattat
ctcccggcaacgaactacttcaaatgtgtacagaaagagattgtaccctacatgagaaga
attgtttctacatggatgttggaggtgtgtgaggaacagaaatgcgaggaggaggttttt
cccctagctatgaattttttggacagatatttgtctattgaacccaccaggaaaacccgt
ctacagttacttggagctacctgcatgtttcttgcgtcaaagatgaaggagaccattccc
ctaactgctgagaagttgagcatatacaccgacaattccatcagaccgggcgaattgctg
caaatggaactactagtattgaacaaactgaaatgggatctagcctcagtgactccgcac
gatttcatagaccatttcctctccaaactacccatccatccggacaccaagcaaatcctg
cgcaagcatgcgcagacctttgtggctctctgtgctacagacgtaaaattcatcgccaac
cctccatcaatgattgcagcgggcagtgttgcggccgcggtccagggcctgcatttgaag
agtgcggacaacgcgctgtcatcccagcagctcactgacttcctgtcccaagtcatccgg
agtgacccggactgtttgcgagcgtgccaagaacagatcgaatccttactggagaccagt
ctccgtcaggcgcaacggcacaccgtttccacggagaccaagaacgtggacgaggagctg
gacctttcgtgcacaccaacggacgtgagggacgtgaacatctga

KEGG   Esox lucius (northern pike): 105020240
Entry
105020240         CDS       T04894                                 

Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04110  Cell cycle
els04115  p53 signaling pathway
els04218  Cellular senescence
els04310  Wnt signaling pathway
els04340  Hedgehog signaling pathway
els04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105020240
   04340 Hedgehog signaling pathway
    105020240
   04068 FoxO signaling pathway
    105020240
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    105020240
   04115 p53 signaling pathway
    105020240
   04218 Cellular senescence
    105020240
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105020240
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 105020240
NCBI-ProteinID: XP_010885403
UniProt: A0A3P8XHT0
LinkDB
AA seq 304 aa
MNRTMELYCLEPNKVVRAQIDHTILFDERVLQSLLNIEDRFLPQCSYFKCVQKDIQPYMR
RMVAEWMHEVCEVEKCEEDVFPLAINYLDRFLAIQHTKKSVLQLLGAVCMFLASKLKGSF
PLTVEKLCMYTDNTFTPRELLEWELVVLGKLKWNMAAVIPNDFVDHILRRLALPKEKLSV
VRKHTQTFIALCATDFSLAMNPPSMIATGSVGAAVCGLQLDQSDPALSRDHLTDLLAKIT
STEVDCLKECQEQIERVLISSLRQGQHQQEAGGRAGSKATEQQDQSSTPTDVSSTPTDVR
EVNL
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaaccgaacaatggaactttattgcctcgagccgaacaaagtcgtgagagcccaaatt
gaccacaccattctatttgatgaaagagtattgcaaagtctgctgaacattgaagacagg
tttctaccgcagtgttcgtattttaaatgtgtccagaaggatattcagccatatatgaga
cgtatggttgcagagtggatgcacgaggtttgtgaagtggagaagtgtgaggaagatgtt
ttccccctggctattaattatttggatagatttttagcaatacagcacaccaaaaagagt
gttttgcaacttctgggagctgtgtgtatgttccttgcatcaaaactaaaggggagtttt
ccattaactgtagaaaagctgtgcatgtacacagacaacaccttcacaccaagggagctg
ctggagtgggagctggtggtcctagggaagttgaagtggaacatggcagcggtcattccc
aatgactttgtagatcacatcctacgcagactggccctgcccaaagagaagctatctgtg
gttcgcaaacacacgcaaacattcatcgccctgtgtgccacagatttcagcttggccatg
aaccccccctccatgatcgccacaggcagtgtgggggcagctgtctgtggcctacagctg
gaccaatcagacccggccctgagtcgagaccatctgactgacctgctggccaagatcact
agcactgaggtggactgcctgaaggagtgtcaggagcagatagagagggtgttgatcagt
agcctgcggcaggggcagcatcagcaggaggccggaggcagggcaggcagcaaggccaca
gagcagcaagaccagtcaagcaccccgacagacgtgtccagcaccccgacagatgttcgc
gaagtcaacctatga

DBGET integrated database retrieval system