KEGG   Esox lucius (northern pike): 105013030Help
Entry
105013030         CDS       T04894                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
els  Esox lucius (northern pike)
Pathway
els00052  Galactose metabolism
els00500  Starch and sucrose metabolism
els01100  Metabolic pathways
els04142  Lysosome
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105013030 (gaa)
   00500 Starch and sucrose metabolism
    105013030 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105013030 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105013030 (gaa)
Enzymes [BR:els01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105013030 (gaa)
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105013030 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 105013030
NCBI-ProteinID: XP_010872569
LinkDB All DBs
AA seq 960 aa AA seqDB search
MGSFSRLSAPSLSLAALTLALLTLLHISYLSHPKVSLIKYNTQQDKTPIHLIQKNGLLED
PVTEHSHEEDILYLLRGGSHLAPRPKWPRESRHTASSRGPRKTECRRVALESRFDCGRDR
VLSQTECEERGCCYAPLPQDLSGGPPWCFYPPSYSGYRMGPLKPSSKGQAATLIRSTPSY
LPRDIDKLRLEVLEETDGRLHFTLKDPSAQRYEVPLSAPQTKVNADTEDRLYVTEFQHDP
FGFIVRRKSNGRVLLNTTVAPLLYADQYLQLSTSLASPLVSGLGEHYTPLTLDINWTSLA
LWNRDMAPHGDANLYGSHPFYLVQEQDGQAHGVFLLNSNAIEVVLQPSPALTWVALGGIL
DLYVFLGPDPQSVVTQYLQVIGFPMMPPYWSLGFHLCRWGYRSTSETREVVRRMNDANIP
LDVQWNDLDYADKRRVFTFDSQRFGDLPDMVKEFHQKGMKYILILDPGISSSSPPGTYPP
FDEGQRRGVFIRNATGQTLIGEVWPGPTAFPDFTNTETQSWWEDCIREFHSKVPLDGLWI
DMNEPASFVPGSVEGCPDSDLESPHYVPRVVGSQLNAGTLCMSGQQNVSTHYNLHNLYGL
TEAYSTHSALVKVRGSRPFVLSRSSFPGIGRFSAVWTGDVRSDWDQLRYSIPAVLLFGLF
GTPLVGADVCGFGGDTTVELCVRWTQLGAFYPFMRNHNDKPNSPQEPYVFGEEAQAAMRS
AVMLRYSLLPFLYTLFHQAHTSGKTVARPLFLEFPLDLSCQTIDRQFLWGSCLLISPVLE
QGAAELAAYFPAGIWYSLHNGEPFYSKGQYQLLPAPLDTINVHVREGHIIPQQEPALTTS
ASRSNPFLLTVALSAEGCAWGDLFWDDGDSLDTFQRADYSYVIFIAEQSQVVSDPLHQNG
ALDRLVLGGVRVFGVPSPPRYVWANGETVRDFTYQTATKVLSVKSLDLPMSKVFQVQWTL
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtttagtcgtctctctgccccctccctgtcacttgctgccctaaccttggcc
ttgttaacacttttacacattagctacctgtctcacccaaaggtctcactgataaaatac
aacacacaacaggacaagactccaatacacctgatacaaaaaaatgggttactggaggat
ccagtgacagaacattcccatgaggaggatatcttgtaccttctgagaggtggctctcat
ttagcccccagacccaaatggccgagggaatcccgtcacacagccagctctcgtggtccc
cgtaaaacagagtgtaggagggtagccttggagagccgctttgactgtggccgggaccgg
gttttgagccagacagagtgtgaagagagagggtgctgctatgcgcccctaccacaagac
ctctccggaggacccccctggtgcttctaccccccgtcctacagtgggtacaggatggga
cctctcaaacccagctccaaaggccaggcagcgaccctgatcagatccactccctcctat
cttcctcgggacattgataaactcagactggaggtcctggaggaaacagacggccgactg
cacttcacactaaaagatccatcggcccagcgatatgaagttcccctatctgctccccag
accaaagttaacgctgacactgaggaccgcctttatgtcactgaattccagcatgacccc
tttggcttcatagtgcgtcgcaaatccaatggtcgtgttcttctgaacaccacagtggcc
ccgctgctctatgccgaccagtacctgcagctgtccacctccctggcctcccccctggtg
tcgggactgggggagcactacacccctctcaccctggacatcaactggacctcactggcc
ctgtggaacagagacatggcgccccatggcgatgccaacctgtatggctcccatccgttc
tacctggtccaggagcaggatggacaggctcacggggtcttcttgctcaacagcaatgct
atcgaggtggtgctgcagcccagccctgctctgacctgggtggccctgggaggaatcctg
gacctgtacgtcttccttggccctgacccccagagtgttgtcacacagtacctccaggtc
atagggttccctatgatgcctccttattggtcactggggttccacctatgtcgctggggc
tatcggtcaaccagcgaaactcgtgaagtggtgcgacgcatgaacgatgcaaacatcccc
ttggatgtacagtggaatgacctggactacgcagacaagcgccgtgtgtttacctttgac
tcccaacgcttcggggaccttccggacatggtgaaagagttccatcagaagggcatgaag
tacatcctcatcctggaccctgggatcagcagcagcagtcctcctggtacttacccaccc
tttgatgaggggcagcggagaggggtgttcatcagaaacgccacaggacagactctcata
ggggaggtttggcctggtccaacagcgttccccgacttcaccaacacagagacacagagc
tggtgggaggactgcatccgggagttccactccaaagtacccttggatggcctttggatt
gatatgaatgaacctgctagttttgtaccaggctctgtggagggctgtcctgacagtgat
ttggagagtccccattatgttccacgggtggttggaagtcagctgaatgctgggactctc
tgcatgtcaggccaacagaacgtgtccactcactacaacctgcataacctctatgggctg
acggaggcgtacagcacccacagtgccctggtgaaggtgcggggctcacggccctttgtc
ctgtcccgctcctccttccctggcatcggacgtttctccgcagtctggactggagatgtg
cggagcgactgggatcagctccgatactccatcccagcggtgttgctgtttggcctgttt
gggactccgttagtgggagcagatgtgtgtgggtttggaggggacaccacagtggagctg
tgtgtacgctggacccagttaggagccttttaccccttcatgaggaaccacaacgacaag
cccaactctccccaggagccgtacgtgtttggggaggaggcccaggcagccatgcggagc
gcggtgatgttgcgttactctctcctgccattcctgtacacactcttccaccaggcacac
acctctggaaaaaccgtggccaggcccctcttcctcgagttccccttggaccttagctgc
cagactatagacagacagttcctgtgggggagctgtctgctcatcagtcctgtgttagag
cagggggcagcggagctggctgcctacttccccgcagggatttggtacagtctgcacaac
ggtgagcccttctacagtaagggtcagtaccagctccttccagctcccttggacaccatc
aacgtccatgtgagagaaggacacatcatcccacagcaggagccagccctgaccacctca
gcctctcgcagtaaccctttcctcctgacagtcgcgctgtctgctgaagggtgtgcgtgg
ggtgaccttttctgggatgacggggacagcctggacactttccagagggcagactactct
tatgtcatcttcattgctgaacagtcccaggtggtgagtgaccccctgcatcagaatggg
gcactggataggcttgtgctgggaggggtgcgtgtgtttggagtgccctctccaccccga
tacgtgtgggccaatggggagacagtgagggatttcacctatcagacagccactaaggtt
ctatcagtgaagagtctggacctgcccatgtcaaaggtgttccaagtccagtggacctta
tag

DBGET integrated database retrieval system