KEGG   Esox lucius (northern pike): 105013076
Entry
105013076         CDS       T04894                                 

Gene name
raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04270  Vascular smooth muscle contraction
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04540  Gap junction
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
els05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105013076 (raf1)
   04012 ErbB signaling pathway
    105013076 (raf1)
   04370 VEGF signaling pathway
    105013076 (raf1)
   04371 Apelin signaling pathway
    105013076 (raf1)
   04068 FoxO signaling pathway
    105013076 (raf1)
   04150 mTOR signaling pathway
    105013076 (raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105013076 (raf1)
  09143 Cell growth and death
   04210 Apoptosis
    105013076 (raf1)
   04218 Cellular senescence
    105013076 (raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105013076 (raf1)
   04540 Gap junction
    105013076 (raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105013076 (raf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105013076 (raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    105013076 (raf1)
   04912 GnRH signaling pathway
    105013076 (raf1)
   04914 Progesterone-mediated oocyte maturation
    105013076 (raf1)
   04916 Melanogenesis
    105013076 (raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105013076 (raf1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105013076 (raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105013076 (raf1)
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105013076 (raf1)
Protein kinases [BR:els01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   105013076 (raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-C3HC4_2 Kdo zf-RING_2
Other DBs
NCBI-GeneID: 105013076
NCBI-ProteinID: XP_012991398
UniProt: A0A3P8Y9C7
LinkDB
AA seq 644 aa
MEHIQGSWKTLSNGLGLTDSGFEDPCSPTIIKSFPYQRRSSDDSKMGDLKTSSTIRVYLP
NKQRTVVNARPGMTLHNCLFKALKVRGLQPEYCAVFRLHPGQRSRKSRMDWNTDATSLIG
EELLVDVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTM
CVDWSNIRQLLLFPTPGEMCGSTLPPLTSRRMRDSLSRFPVSSQHRHSTPHAFDFHLSAG
PVSGAEPVVLSHRLRSTSTPNVHMVTTTSIPLDTTAFQDAIKSHESESPPDLSPTGCSMS
GQCRAPAPAPRERAVSSNAQDKHRIRPRDKRDSSYYWEIEASEVVLQNRIGSGSFGTVYK
GKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCD
GSSLYNHLHVQETSLQMFQLMDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIG
DFGLATVKARWTGSHQVEQPSGSILWMAPEVIRMQDNNPYSFQSDVYSYGVVLYELMTGR
LPYSMMATRDQIIFMVGRGYLSPDLSKLYKSCPKAMKRLVADCIKKSKEERPLFPQILSS
IELLQHALPKINRSTSEPSLHRATHTEDINICTLTYTRQPAAVF
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggagcacatccaggggtcctggaagaccctgagtaatggcttgggcctaacagactct
gggtttgaggatccctgttcacctacaatcatcaagagcttcccataccagagacgctcc
tcagacgacagcaagatgggagacctcaagacctccagcactattagagtctacctgccc
aacaaacagcgcactgtggtgaatgcccggccaggtatgactctccacaactgtctgttc
aaggctctgaaggtgcgaggcctccagccggagtactgtgctgtgtttagactacaccca
gggcagagaagcaggaagtccaggatggactggaatactgatgcaacctcgttgataggg
gaggagttactggtggacgttctagaccacgttcctctcaccacacacaattttgtcaga
aagacatttctaaagctggcattctgtgacatctgtcagaagttcctgcttaatgggttc
cgctgtcagacgtgtggctacaagttccatgaacattgtagcaccaaagtgcccaccatg
tgtgtggactggagcaacatcagacagctgctcctgttccccactcctggggagatgtgt
ggttctactctccctcccctcacatcacggcgaatgagagattccctctccagattccct
gtcagctcccagcaccgacactcaacccctcatgccttcgacttccacctgtctgctggt
cctgtatcaggggctgagccggtcgtcctttcccaccgcttgagatccacctcaacccct
aacgtacacatggtcaccaccacctccataccactggacaccactgccttccaggatgcc
attaaaagtcatgaatctgagagccctcctgacctcagcccaacaggctgttccatgtct
gggcaatgtcgtgctcctgctcccgcgcccagggagcgagctgtctcctccaacgctcag
gacaaacacagaatccggcccagagataagcgggactcttcatactactgggagatcgag
gccagtgaggtggtactccaaaaccggatcggatcgggctcctttgggacagtctataaa
gggaaatggcatggtgacgttgcagtgaagatcctgaaggtggtagatcctacaccagaa
cagtttcaagccttcagaaatgaagtggctgttctcaggaagacacgccacgtcaacatc
ctcctcttcatggggtacatgaccaaagacaacctggccattgtgacccagtggtgtgac
ggctccagcctctacaaccatctccatgtccaggagaccagcctgcagatgtttcagctg
atggacattgccaggcagacagcacagggcatggattacctacatgccaagaatattatt
catcgggacatgaagtccaacaatatcttcctccatgagggcctgaccgtaaagattgga
gactttggactggccacggtgaaggctcgctggacgggctcacatcaggtggagcagcct
tctgggtcgatactatggatggctccagaggtgatccggatgcaggacaacaacccctac
agtttccagtcagatgtctattcctatggagtggtgctctatgaactcatgacgggacga
ctgccatacagcatgatggccacacgggaccagatcatcttcatggttgggagaggttac
ctctccccagacctcagtaagctgtacaagagctgtcctaaggccatgaagagactggta
gctgactgcatcaagaagtcaaaagaggagaggccccttttccctcagatcctgtcttcc
attgagttgctgcagcatgctttgcctaagattaaccgcagcacctccgagccgtcgctc
catagagcaacacacaccgaggacatcaacatctgcactttgacctacactcgtcagccc
gccgcggtcttctag

KEGG   Esox lucius (northern pike): 105029139
Entry
105029139         CDS       T04894                                 

Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase-like isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04012  ErbB signaling pathway
els04068  FoxO signaling pathway
els04140  Autophagy - animal
els04150  mTOR signaling pathway
els04210  Apoptosis
els04218  Cellular senescence
els04270  Vascular smooth muscle contraction
els04370  VEGF signaling pathway
els04371  Apelin signaling pathway
els04510  Focal adhesion
els04540  Gap junction
els04625  C-type lectin receptor signaling pathway
els04810  Regulation of actin cytoskeleton
els04910  Insulin signaling pathway
els04912  GnRH signaling pathway
els04914  Progesterone-mediated oocyte maturation
els04916  Melanogenesis
els05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105029139
   04012 ErbB signaling pathway
    105029139
   04370 VEGF signaling pathway
    105029139
   04371 Apelin signaling pathway
    105029139
   04068 FoxO signaling pathway
    105029139
   04150 mTOR signaling pathway
    105029139
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105029139
  09143 Cell growth and death
   04210 Apoptosis
    105029139
   04218 Cellular senescence
    105029139
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105029139
   04540 Gap junction
    105029139
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105029139
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105029139
  09152 Endocrine system
   04910 Insulin signaling pathway
    105029139
   04912 GnRH signaling pathway
    105029139
   04914 Progesterone-mediated oocyte maturation
    105029139
   04916 Melanogenesis
    105029139
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    105029139
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    105029139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105029139
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     105029139
Protein kinases [BR:els01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   105029139
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2 zf-RING_2
Other DBs
NCBI-GeneID: 105029139
NCBI-ProteinID: XP_010900627
LinkDB
AA seq 646 aa
MEHLQGAWKTLSNGFGMKDSVFENPCLSPTMVQGFPYQRRSSDEGKTPDSKASSTIRVYL
PNQQRTVVNVRPGMTLHSCLIKALKVRGLQPECCAVFRLHPGQRSKKSRMDWNTDSTSLI
GEELLVEVLDHVPLTTHNFVRKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPT
MCVDWSNIRQLLLFPTPGESGGPSLPPFTSRRMRESLSRPPSSSLHRYSTPHTFNYTAPY
PPTEGAVFQRQRSTSTPNVHMVSTTLLHPVDSSMIEEAMRNHEPVCNYNSGGSSPSQSPT
GWAQPQSKTPAADRRERAPSFNTQEKHKIRPRDKRDSSYYWEIEASEVVLHSRIGSGSFG
TVYKGKWHGDVAVKILKVIDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVT
QWCEGSSLYKHLHVLETNFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLT
VKIGDFGLATVKARWSGSHQVEQPSGSILWMAPEVIRMQDNMPYSFQSDVYSYGIVLYEL
MTGELPYSQIANRDQIIFMVGRGYLSPDLSKLYKSCPKAMKRLVADCIKKIKDERPLFPQ
ILSSIELLQHSLPKINRSASEPSLHRASHTEDINAFTSTYSRLPVF
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggagcaccttcagggagcatggaagaccttaagcaacggtttcggtatgaaggactcg
gtgttcgagaacccctgcctatcccccaccatggtgcagggattcccctaccagcgccgg
tcctcagacgagggcaagacccccgattccaaggccagcagcaccatccgcgtctacctg
cccaaccagcagcgcactgtggttaacgtgaggccaggtatgaccctgcacagctgcctg
atcaaagctctgaaggtgcggggcctgcagccggagtgctgcgctgtcttcagattgcac
cctggacagaggagtaaaaagtcacgtatggattggaataccgactctacctcgctaatt
ggggaagaactgcttgtggaagttttagatcacgttcccttgacgacgcacaactttgtt
cggaaaacatttctgaaattggccttctgtgatatatgccagaagttccttttgaatggt
ttccgttgccaaacatgcggctataaattccatgagcattgcagcaccaaagtgcccacg
atgtgtgtggattggagcaacatcagacagctcctattgttccccacaccaggagaaagt
gggggtccatctcttcctccctttacatctcggcgaatgagagaatcactatcccgcccc
cctagcagttccctgcaccgctactccacccctcacaccttcaactacaccgccccctac
ccacccacagagggtgctgtcttccagaggcaacgctccacctccacgcccaacgtccac
atggtcagcaccaccctgctccaccctgtcgacagcagcatgatcgaggaggcaatgcgt
aatcacgaaccagtgtgtaattacaactccggtggtagctccccgagccagagtcccaca
ggctgggcccagccccagtccaaaaccccagcggcagacagacgtgagagggctccatca
ttcaacactcaggagaaacacaaaatacgtccgagagacaagcgggactctagttactac
tgggagatcgaggccagtgaagtggtgctgcactcccgtatcggttcagggtccttcgga
actgtgtacaaagggaaatggcatggtgacgtagcagtgaagatcttaaaggtgattgac
cccaccccggaacagttccaagccttcagaaacgaggtggctgtccttaggaaaacgcga
cacgtcaacatcctgttgttcatgggttacatgacaaaggacaacctggccattgtgacc
cagtggtgtgagggaagcagcctttacaaacacctccacgtactggagacaaacttccag
atgttccagctaatcgatatcgccaggcagactgctcagggcatggactatcttcatgcc
aaaaacataatccacagagacatgaaatccaacaatatcttcttacatgagggcctgaca
gtgaagattggagacttcggtctggccaccgtcaaagccaggtggagcggttctcaccag
gtggagcaaccctctgggtccatactgtggatggccccggaggtgatccggatgcaggac
aatatgccctacagtttccagtctgatgtgtactcttatggtattgtcctctatgagctg
atgactggagagctgccttactcccagatagccaacagagaccagatcatattcatggtc
ggccgagggtacttgtctcctgacctcagtaaactctataagagctgcccgaaagccatg
aagaggctagtggccgattgcatcaagaagatcaaggacgagaggccgctgttccctcag
atcctgtcgtccatcgagctgctccagcactccctgcccaagatcaaccgcagtgcctca
gagccgtccctgcacagagcctcacacactgaggacatcaatgctttcacgtcaacctac
agccggctgcctgtgttctag

DBGET integrated database retrieval system