KEGG   Esox lucius (northern pike): 105013210Help
Entry
105013210         CDS       T04894                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14 isoform X1
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04210  Apoptosis
els04625  C-type lectin receptor signaling pathway
els04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105013210
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105013210
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105013210
   04672 Intestinal immune network for IgA production
    105013210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105013210
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     105013210
Protein kinases [BR:els01001]
 Serine/threonine kinases: STE group
  Other
   105013210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 105013210
NCBI-ProteinID: XP_010872873
LinkDB All DBs
AA seq 922 aa AA seqDB search
MKTADAFYKRKNNGLKLGKAGEMAVRHRILNSTRPFSGPEQKGSFQRCPSPDERTVDKEG
MKSNVDMMACFKPGLFNALTKGTAEQVGEAGPQDYQKNAFLIAQAECETSDSQEFSPSCS
ERPYVASPNLMNRHGCRGYPSASSDQNNVASSTAASDQDKAGSRTIRQPRRKPRKKQNRK
EKKKDAQRESQKPKQRCQKPKQRCRVPSGVPEQESQSCSSSLLILSHEDSLGSPSCNTSY
SIQILDTQDKRCSFYPLQDSNRGPSLPPRGWGPQVFSPPSNHPAYGQESDSDSPVCSVGD
FTLALAGLRGSVSQGDRCYAGPFCKDVERDVREQEEKEEGEISVADINEGLIFNENLEPV
NYEYREGKDYSLCHPIKSGSYGEVYSVRDNRTHFRFAAKKIPLEGFSSEEVGTWSALKSP
RVVELFGVVREGPYAILFMDLKAGSVGQLIKDSGRLAEDLALHYHQQVLGALEHLLRRRV
LHLDIKADNVLLSEDGRDTFLCDFGHSERMDTRGQSLRASWGELKGTETHMAPEMVKGEA
RGAKADVWSSCCMLLHMLNGCQPWTRYYSRPLYLKIANEPPPLREIPPDCSPFTANVIKA
GLQKEPNERASASELRGKVARALKEVGGLSSPVRGCYKEPLQLDSSPSPTGQPQSPSSTR
TCSEEHCELWLKHLSHGRKRKELEEEEEESHELEVGQDEEEVEGEAYEEKTSPPGSSLCL
LAQLRDCQNPKMADATSTMSELELRKLERDFYLTSLSQLHTPETQEQLLSCLSSSDCYSN
RDLWDRKDSGRWSINPGDDLSSGVFSCNSQPEGQILSMDWLGQHTHLSQPQCFQGVDVSI
TGVNGQSIQIREKRRVKVGHIATGISDQISERAFTMETQEGDPVAHDEEVQESGLLLRCV
LAPDYSEAWRWRVKEGVLETRN
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagccgacgccttttataagcgtaaaaacaacggacttaaactaggcaaggcc
ggtgagatggcggtgaggcataggatcttaaactcgaccagaccgttctcagggccagaa
cagaaggggtctttccaaaggtgccccagccccgacgagaggacggttgataaggagggg
atgaagagcaacgtggatatgatggcgtgttttaaacccgggctgttcaatgccctaacc
aagggaacggcggaacaagtgggtgaagcgggtccacaggactaccagaagaatgcgttc
ctcatagcccaggcagaatgtgaaacctcagactcccaggagttcagcccttcctgctcc
gaacgcccctatgtcgcatcccccaacttaatgaacagacatggttgccgcggctacccc
agtgcttcctcggaccagaacaacgtggcctcgtccactgctgcctccgaccaggacaaa
gcaggctcccgcacaatccggcagcccaggaggaagcccaggaagaaacagaatcggaaa
gagaagaagaaagatgcacagagggaaagtcagaagccaaagcagagatgtcagaagcca
aagcagagatgtagagtgccttctggtgttcctgagcaggagagtcagagttgcagttcg
tctctactcatcctgagccatgaggactctctagggagcccgagctgcaacacgtcctac
agcatccagatattggacacacaggacaaacgatgctccttttaccctctccaggactcc
aacaggggccccagtcttcccccccgaggctggggcccccaggtgttcagccccccctcc
aaccaccccgcctatgggcaggagagtgactcggactcccctgtctgtagtgtaggagac
tttactctggccctggcggggctccggggcagtgtcagccagggggaccgatgctacgca
ggtcccttctgcaaagatgtagagagggatgtgagggagcaggaggagaaggaggaggga
gaaatctcagtggcagacatcaacgagggcctgatctttaatgagaacttagagcctgtg
aattatgagtacagggagggaaaggactacagcctctgccaccctatcaagtctgggtca
tacggggaagtctacagtgtgagagacaacagaacgcacttcagatttgctgccaaaaag
attcccctggagggtttcagcagtgaggaggtgggcacgtggagtgccctgaagtctcct
cgcgtggtggaactcttcggagtggtcagagagggaccttacgccatcctcttcatggac
ctaaaagctggctctgtgggccagcttattaaagacagtggacggctggctgaggacctg
gccctgcactaccaccagcaggtgctaggggcgctggagcatctgctgaggagacgagtg
ctgcatctggacataaaggcggacaatgtgttgctgtcagaggatgggagggacaccttt
ctgtgtgactttggacactcggagagaatggacacccgtggacagagcctcagggcatcc
tggggagaactgaaggggacggagactcacatggctccggagatggtgaaaggggaagcc
cgtggagccaaagcagacgtgtggagcagctgctgcatgttactgcacatgctcaatggc
tgccagccctggacacgatactattcccgcccactttacctcaagatagccaatgagcca
ccgcctctaagggagatcccgcccgactgcagtcccttcacagccaatgtcattaaggca
ggactacagaaggagccgaacgagagggcctctgcctccgagctcaggggaaaagtagcc
agagccctgaaagaagtgggaggactcagcagccccgtcagagggtgctataaggagccc
cttcagttagacagcagccccagtccaactggccagccccaatcgccctccagcacacgt
acctgctctgaggagcactgtgagctatggctgaaacatctcagtcatgggaggaagagg
aaagagctggaggaggaggaggaagagagtcatgaactggaagttgggcaggatgaggaa
gaagttgagggtgaggcatacgaggagaaaacctcacctccaggctcttctctctgtctg
ctggcacaactccgtgattgtcaaaaccccaagatggctgacgccacctccaccatgtct
gagcttgaactgcgcaaactggaaagagatttctacctgaccagtctgtctcagctgcac
acacctgaaacacaggagcaactgctgtcttgtctgagcagcagtgactgctactccaac
agggacttatgggacagaaaggattctggacgttggtccatcaacccaggtgatgacctc
agctccggagtgttttcctgcaacagccaaccagaaggacagatccttagtatggactgg
ctgggccaacacacacacctgtctcaacctcagtgctttcagggggtggatgtcagcatc
actggcgttaacgggcagagcatccagatccgagagaaacgcagggtgaaggtgggccat
attgccacagggatcagtgaccagatctcagagagagcattcactatggagactcaggag
ggagacccagttgcccatgatgaggaggtgcaggaatctggcctcctgctccgctgtgtc
cttgctcctgactacagtgaagcgtggagatggagggtcaaagaaggcgtgctggagacc
cgcaactaa

DBGET integrated database retrieval system