KEGG   Esox lucius (northern pike): 105013350
Entry
105013350         CDS       T04894                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
els  Esox lucius (northern pike)
Pathway
els04068  FoxO signaling pathway
els04217  Necroptosis
els04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105013350 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    105013350 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    105013350 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105013350 (stat3)
Transcription factors [BR:els03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    105013350 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Macoilin PRKCSH-like DUF2408
Other DBs
NCBI-GeneID: 105013350
NCBI-ProteinID: XP_010873116
LinkDB
AA seq 808 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSTYLEKPMEIARIVARCIWEEQRLLQNAT
TTAQDGTAAHPSGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGDNPPNSSPICSELSQDMNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGLLSAM
DFVQKNLTDDELADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQ
QKVSYKGDPIIQHRPALEEKIVDLFRSLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNK
VRLLVKFPELNYQLKIKVIIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEF
KHLTLREQRCGNGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNIC
QMPNAWASILWYNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLNIEQLTTL
AEKLLGPSVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGF
ISKERERAILSPKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSM
SFAEIIMGYKIMDATNILVSPLVYLFPEIPKEEAFGKYCRPEAAPEEAPGGDPYSTIQPY
LKTKFICVTPCPSVFMDFPDSELLGNGIFPGTNSGNTSDLFPMSPRTLDSLMHNEAENNP
GPLALLLSVFPDSLTLDMELSSDVASPM
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggcccaatggaaccagttgcagcagctggagaccaggtatctggaacagctctaccac
ctgtacagtgacagcttccccatggaactccggcagttcctcgccccctggatcgagagt
caggactgggcgtacgcagccaacaaagagtcccacgcaacactggtgtttcacaaccta
ctgggggagatcgaccagcagtacagccgcttcctgcaggagaacaatgtgctctaccag
cataacctacggcgtatcaagcagcacctgcagtccacgtacctggagaagcccatggag
atcgcccgcatcgtggcccgctgtatctgggaggaacagaggctgctgcagaacgccaca
accactgcgcaggacggaacagcggcacatccgtccggcactgttgtgacagagaaacag
cagattctggagcacaacctgcaggacatcaggaagagagtgcaggatatggaacaaaag
atgaaaatgctcgagaatctccaggatgattttgacttcaactacaagacccttaaaagt
cagggtgataacccacccaactcctctcctatttgctcagagttgtcccaggacatgaat
gggaacagccaggcagctgccacgagacagaagatgtctcagttggaacagatgctgagt
gctctggaccagctcaggaggcaaatagtgactgagatggccggtctgctgtcagccatg
gacttcgtccagaagaacctgactgatgatgagctggccgactggaagagaaggcagcag
atcgcctgtatcggaggaccacccaacatctgcctggaccgcctggagacatggatcaca
tccctggccgagtcccaactgcagatccgccagcagatcaagaagctggaggagctccag
cagaaggtgtcctataagggcgaccccattatccagcaccggcctgctttggaggagaag
atagtggacctgttcaggagcctcatgaagagtgccttcgtggtggagaggcaaccttgt
atgcccatgcatcctgatagaccactggtcatcaagacgggcgtgcagttcaccaacaaa
gtcagattattggtgaagtttccagaattgaattaccagttgaagattaaagttattatt
gacaaggaatctggggacgtggctgctattcgaggatccagaaagtttaacatcctggga
accaacaccaaggtgatgaacatggaggagtcaaacaacggcagtctgtctgcagagttc
aaacacctgacgctgagagaacagaggtgtggcaatggtggcaggaccaacagtgatgca
tcccttatcgtcacagaggagctccacctcatcacatttgagaccgaggtctaccaccag
ggcctgaagatcgacctggagacccactctctgccagtggtggtgatctccaacatctgc
cagatgcccaacgcctgggcctcaatcctgtggtacaacatgctgaccaaccaccccaag
aacgtgaacttcttcaccaagcccccggtggggacctgggaccaggtggctgaggtcttg
agctggcagttctcctccaccacgaagaggggcctgaacattgagcagctcaccaccctg
gctgagaaactgctaggtccatctgtgaactactctggatgccagatcacctgggcgaag
ttctgcaaagaaaacatggcgggtaaaggcttctccttctgggtgtggctggacaatatc
attgacctggtcaagaagtacatcctggctttgtggaatgaagggtatatcatgggtttc
atcagtaaggagagggagcgggccattctgagccccaagcctcctggcaccttcctgctg
cgcttcagcgagagcagtaaggaaggaggcatcaccttcacttgggtggagaaggacatc
agtgggaagacccagattcagtcggtggagccgtacaccaagcagcagctcaacagcatg
tcttttgcggagatcattatgggatacaagatcatggatgccaccaacatcctggtgtcg
ccgctggtctacctcttcccagagatcccgaaggaggaggcctttgggaagtactgccgg
ccggaagctgccccggaagaggccccgggaggggatccctacagcaccattcaaccgtac
ttgaagacaaagtttatctgtgtaactccgtgtccctccgtgttcatggacttcccggac
agcgagctgcttgggaacggcattttccctggcactaactctggcaacaccagtgacctg
ttccccatgtccccccggaccctggactctctgatgcacaatgaggctgagaacaaccct
ggtccgctggccctcttgctgtccgtcttcccagattctctcactctggacatggagctg
agttcagatgtggcgtctcccatgtga

DBGET integrated database retrieval system