KEGG   Esox lucius (northern pike): 105013383
Entry
105013383         CDS       T04894                                 

Gene name
mgrn1
Definition
(RefSeq) E3 ubiquitin-protein ligase MGRN1
  KO
K10604  E3 ubiquitin-protein ligase MGRN1 [EC:2.3.2.27]
Organism
els  Esox lucius (northern pike)
Pathway
els04120  Ubiquitin mediated proteolysis
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105013383 (mgrn1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105013383 (mgrn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:els04121]
    105013383 (mgrn1)
Enzymes [BR:els01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     105013383 (mgrn1)
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    105013383 (mgrn1)
SSDB
Other DBs
NCBI-GeneID: 105013383
NCBI-ProteinID: XP_028979683
LinkDB
AA seq 254 aa
MGSILSRRIAGVEDIDIQANSAYRFPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDL
NFLGNRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDTDSPLEEGGKPKVLYGV
EFTFDADARVAINLYCQAFEEFSNGMAVYNPKDPSLVSETVHYKRGVSQHFSLPSFKIDF
TDWKEEDLNFDLDRGVFPMVIQAVVDEGDDCLGHAHVLLAAFEKHVDGSFSVKPLKQKQI
VSKYLSFLLLKICM
NT seq 765 nt   +upstreamnt  +downstreamnt
atggggtcgattcttagtcggagaatcgctggtgttgaggatattgatatccaggcgaat
tctgcgtacagatttccaccaaagtcaggaaattattttgctagtcattttttcatggga
ggggagaaatttgacactccacatccagagggatacctatttggggaaaacatggatttg
aacttccttggaaataggcctgtgcaattcccgtatgtgaccccagcaccccatgagcct
gtaaagaccctgagaagtctggtcaatatcaggaaggactctctacggttggtcaggtac
aaggatgacactgactctcctctagaggaaggaggaaagcccaaggttctgtatggtgtg
gagttcacctttgatgctgatgctcgtgtggctatcaacctttactgccaagcctttgaa
gagttctccaatgggatggcagtgtataacccaaaggatccatccttggtttctgagact
gtacattataaaagaggtgtgagccaacatttctccctgccttctttcaaaattgatttc
accgattggaaggaggaggatctgaactttgacctggaccgaggtgttttccccatggta
atccaagctgtggtggatgaaggggatgattgcttgggacatgcacatgttctgctggca
gcttttgagaaacatgtggatggcagtttctctgtcaagcctctgaagcagaaacaaatt
gtaagtaaatacctgtcttttctgttgctcaaaatctgcatgtga

DBGET integrated database retrieval system