KEGG   Esox lucius (northern pike): 105013551
Entry
105013551         CDS       T04894                                 

Gene name
dhh
Definition
(RefSeq) desert hedgehog protein
  KO
K11990  desert hedgehog
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105013551 (dhh)
Peptidases and inhibitors [BR:els01002]
 Cysteine peptidases
  Family C46: hedgehog family
   105013551 (dhh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 FAD_binding_9
Other DBs
NCBI-GeneID: 105013551
NCBI-ProteinID: XP_019906982
UniProt: A0A3P8XX39
LinkDB
AA seq 473 aa
MKVTSWWLSLARLSLLTVFTWSSLVQGCGPGPGNGIRHRPRKLIPMPYKTSSPKLSEYNL
GASGRAEGKITRSSERFNELVCNYNPDIIFKDEEKTLADRFMTKRCKDCLNKLAIAVMNH
WPGTKLRVTEAWDEDGHHPPDSLHYEGRAVDITTSDRMPEKYGILAQLAVEAGFDFVYYE
SKYHVHCSVKADHSVAVEKGGCFPGWARVTVPGEGQKTLDSLEPGDRVMALSESGHLVLS
RVLLFLHRDHESRSTFLVLSTQDGHRIALTPHHLVFLSPRYELLHSEYRARFASRAKPGD
YVLIRGPDGRVQPSRVTSTSQVEGTGVYAPLTEHGTLFVDGVLASSYALIEDHRLSHWAF
GPLRLLLSFTQLVGGGGAPPRVWASGAERERTKAPVHRKRPGAWVNQTLCGPGMDVNTNT
SERQRSWTYVAPNRETEQGHCCSGGGRVSSVYWYARLLHSLGQIFLDPKIFHP
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgaaggtgacctcatggtggttaagcctagcacggctcagcctgctcactgtgttcaca
tggagctccctggtgcaggggtgtgggccaggccccggcaatggcatccgccacaggccc
aggaaactcatccccatgccctacaagacctcttctcctaaactttctgagtataacctg
ggcgccagcgggagggcagagggcaagatcacacgcagctcagaacgtttcaatgaactg
gtgtgtaactacaaccctgatatcatcttcaaagatgaggagaaaacgcttgctgaccgc
ttcatgaccaagcgctgtaaagactgcctcaacaaactggccatagctgtgatgaaccac
tggccaggaaccaagctccgtgtcacagaggcctgggatgaggatggacaccacccgccg
gactccctccactatgagggacgggccgtggacatcaccacctcggaccgcatgccagaa
aagtatggcatcctggcccagctggctgtggaggccgggttcgactttgtgtactatgag
tccaagtaccatgtccactgctccgtcaaagctgatcactcggtggcagttgagaagggg
ggctgtttcccaggctgggcccgggtgactgtgcctggagagggacagaagaccctggac
tccctggagcccggggacagagtgatggccctgtctgagtcgggacacctagtcctcagc
cgtgtccttttattcctgcacagagaccacgagagcaggtccactttcctggtcctaagc
acccaagatggccatcgcattgccctaactccgcaccacctggtcttcctctccccccgc
tacgagctcctccacagtgagtaccgggcccggtttgccagtagggccaaaccgggggac
tatgtgctcatccgcggaccagacggccgagtgcagccctccagggtcacatctacgtca
caggtggaagggacgggtgtatatgcacccctgacagaacacggcaccctgtttgtggat
ggagtactggcatccagctacgctctaatagaggaccacaggctgtcacactgggctttt
gggcccctgagactgctgctctcattcacccagctggttgggggggggggcgcaccgcca
agagtgtgggcctcgggggccgagagggagcgcactaaggcgcccgttcaccgcaagagg
ccaggggcatgggtaaatcagacactctgcggcccaggcatggatgtgaatacaaacact
tcagagagacaaagaagctggacctatgtagccccgaacagagagactgagcagggacac
tgttgctctgggggaggaagagtttccagtgtatactggtatgctaggctgctacacagt
cttgggcagatctttctagaccccaagatatttcatccttag

KEGG   Esox lucius (northern pike): 105019360
Entry
105019360         CDS       T04894                                 

Definition
(RefSeq) sonic hedgehog protein A
  KO
K11988  sonic hedgehog
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105019360
Peptidases and inhibitors [BR:els01002]
 Cysteine peptidases
  Family C46: hedgehog family
   105019360
Glycosaminoglycan binding proteins [BR:els00536]
 Heparan sulfate / Heparin
  Morphogens
   105019360
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint Hom_end_hint Intein_splicing AXH
Other DBs
NCBI-GeneID: 105019360
NCBI-ProteinID: XP_010883789
LinkDB
AA seq 421 aa
MDEMLPLTRIVLVGLICFSLVSSGMGCGPGRGYGRRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNTDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNQW
PGVKLRVTEGWDEDGHHFEESLHYEGRAVDITTSDRDKSKYGTLSRLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGTASVTLKDGSRKAVKDLRVGDKVLAANSDGDLEYSD
FIMFVDQDSSTRRVFYVIETKEPTRKITLTAAHLLFVLNNSTDDLHSMSAVFASKVKPGQ
KVLVFDDLHNQLKTVTVERIYMEEREGSFAPVTVQGTIVVDHVLASCYAVIEDHNLAHWA
FAPVRLSFWLSSLLTPKDYSMPNATLHEEGVHWYSKILYQLGMWLLDSHALHPLGMSINS
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggacgaaatgctgccgttgacaagaatcgttctggtcgggttgatctgcttttccttg
gtgtcctctgggatgggctgtggaccgggcaggggctacgggaggagaagacatccgaag
aagctgacacctcttgcgtacaagcagttcatcccaaacgttgcagagaagaccctaggt
gccagcggcagatatgaaggcaagatcacacggaactctgagcgatttaaagaactgact
cccaattacaatactgacattatctttaaggatgaagagaacaccggtgctgaccggctt
atgactcagagatgtaaagacaagctgaactccctggcgatctccgttatgaaccagtgg
ccaggggtaaagctgcgcgtcacggagggatgggacgaggatgggcaccatttcgaagag
tcgctacactacgagggaagggcagtggatatcacaacctccgatagagacaaaagcaaa
tacgggacgctgtccagactagctgtggaggctggattcgactgggtctactacgagtct
aaggcccatatccactgctctgtcaaagcagaaaactcagttgctgccaaatcagggggc
tgcttcccaggcactgcttccgtaactctgaaagatgggagcaggaaggcagtgaaagac
ttaagagtaggcgacaaggtgttggctgccaacagtgatggggaccttgagtatagcgac
ttcatcatgttcgtggaccaggactcgtccaccagaagagtgttttatgtgatagagact
aaagaacccacccgaaaaatcacccttactgctgcacatcttctctttgtgctcaacaac
tccacagatgatctccacagcatgtctgcagtgtttgcgagcaaagtcaaacctggacaa
aaggtgttggtctttgatgatttacataaccaactgaagacggtcaccgtggaacggatt
tacatggaggagcgtgaggggtcctttgcgcctgtgacagttcaaggaaccattgtggta
gaccatgtgcttgcgtcatgttatgcggtgattgaagatcacaatctagcacactgggcg
tttgcacctgtcagactgagtttctggctgtcctctttgcttaccccaaaagactactcc
atgccgaacgcaaccttacacgaagaaggagtgcactggtattccaagattctttatcaa
ttaggaatgtggctcttggatagccatgcgcttcacccactggggatgtcaataaactca
agttga

KEGG   Esox lucius (northern pike): 105023172
Entry
105023172         CDS       T04894                                 

Definition
(RefSeq) indian hedgehog B protein
  KO
K11989  indian hedgehog
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105023172
Peptidases and inhibitors [BR:els01002]
 Cysteine peptidases
  Family C46: hedgehog family
   105023172
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Peptidase_M15_4
Other DBs
NCBI-GeneID: 105023172
NCBI-ProteinID: XP_010890453
LinkDB
AA seq 427 aa
MLLPWLVTCLVGCAVILSPVSEGCGPGRGYGKRRSSRKLAPLAYKQFSPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNLWPGV
RLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYAMLARLAVEAGFDWVYYESKAH
VHCSVKSEHSVAAKSGGCFPGGAWVTLEDGSKRLIRDVRPGERVLASSASDGSGALVYSE
VLTFLDRDPATRKQFYSIRTESGATLPLTAAHLLFVSEGNCSEGAEPTPGSMRTIYASDA
RLGQCVLTTVASEGVRQGEESMKGAGRFSRISRVSVHEDVGVYAPLTRHGTLAVNGVVAS
CYAVVDGHGLAHWAFAPLRLLYHWTGFAGSHFGDTGVHWYSQLLYWIGSLLLDSEHFHPW
GLTDPGR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgctgctcccctggctcgtgacgtgcctcgtcggttgcgcagtgattctctcgccggtc
agcgagggctgcgggccgggacggggatatgggaagaggcggtcatcgagaaagcttgcg
cctcttgcctacaagcagtttagtcccaatgtagccgagaagacactaggcgcgagcggt
cgatatgaagggaaaattacccggaactccgagcgcttcaaagagctcactccgaactac
aaccctgacatcatattcaaagatgaagagaacacaggggcagaccggatgatgacacag
cgctgcaaggacaagctaaactcactagccatctctgtaatgaacctatggccgggggtg
cgcctgcgggtcaccgagggctgggacgaggacggacaccattcggaggagtcgctgcac
tacgagggacgggcggtcgacatcacaacctctgaccgcgaccgcaacaagtacgcaatg
ttggctagactcgcggtggaggctggcttcgattgggtatactacgagtccaaggcccac
gtgcactgcagcgtcaagtcagagcactctgttgcggctaagtcaggggggtgttttccg
ggaggggcgtgggtgaccctagaagacgggagtaaaaggttgatccgggacgtgcggccg
ggtgagcgagttcttgcctcgtcggcaagcgacggcagtggagcgctagtttacagtgag
gttctcaccttccttgatcgtgaccccgcgacgcggaagcagttctattccatcaggaca
gaaagcggggctaccctgccactcaccgccgctcacctgctgtttgtatctgagggaaac
tgctcggaaggggcggagccgactcctggtagtatgaggacgatatacgccagcgacgcg
aggctggggcagtgcgtgctgacgacagtggccagtgagggggtcagacagggtgaggag
tcgatgaaaggcgcggggcgtttctcacgcatctcccgggtgagtgtgcatgaggacgta
ggagtgtatgcccccctcacccgccacgggacgttggcggtgaacggtgtggtggcgtcg
tgctatgcggtggtggacgggcacggcctggctcactgggccttcgcccccttgcgcctg
ctgtaccattggactggctttgctggaagccattttggagacactggggttcactggtac
tcccagttgctgtactggataggcagtctactgctggactctgaacacttccacccctgg
ggactgactgatccagggaggtga

KEGG   Esox lucius (northern pike): 105024267
Entry
105024267         CDS       T04894                                 

Definition
(RefSeq) tiggy-winkle hedgehog protein-like
  KO
K11988  sonic hedgehog
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105024267
Peptidases and inhibitors [BR:els01002]
 Cysteine peptidases
  Family C46: hedgehog family
   105024267
Glycosaminoglycan binding proteins [BR:els00536]
 Heparan sulfate / Heparin
  Morphogens
   105024267
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Intein_splicing Hint_2 Hom_end_hint
Other DBs
NCBI-GeneID: 105024267
NCBI-ProteinID: XP_010892414
UniProt: A0A3P8YBZ6
LinkDB
AA seq 415 aa
MDVMLILIRIALLGFVCLFLASPGLACGPGRGYGKRRHPKKLKPLAYKQFIPNVAEKTLG
ASGKYEGKITRNSERFKDLTPNYNPDIIFKDEENTNADRLMTQRCKDKLNSLAISVMNQW
PGVKLRVTEGWDEDGHHFEESLHYEGRAVDITTSDRDKSKYGMLSRLAVEAGFDWVNYES
KAHIHCSVKAENSVAAKSGGCFPGSASVLLEDGRKKLVQELEFGDKVLAADKEGNIVSSD
FLMFIDRDTTTRREFYVFETEKPSRKLRLTPAHLVFVTNNITDSEMTAVFASNVQPGQRV
FVVDEALNRLKAVTVERIYVEEYEGSYAPITSQGTIIIDHVLASCYAVIEDHKWAHWAFA
PVRLGHALMSLTGLVKERKDLLQSDGIHWYTEVLYRIGTLLLDKNSFHPLGMLQS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggacgtgatgctgatattgataagaattgcgcttctgggtttcgtctgcctgttcctt
gcatcccccgggttggcctgtggtccaggcagggggtatggaaaacgaagacatccgaaa
aaactgaagcctttggcttacaagcagtttattcccaacgtggcggaaaagacccttggg
gccagtggtaaatacgaagggaagatcacaaggaactctgaaagatttaaagatctgaca
ccaaactacaatccggacattatttttaaagatgaggaaaacacaaacgctgacagacta
atgacacagagatgcaaggacaaactgaactctttggctatttcagtaatgaatcagtgg
ccgggagtgaagctgcgcgtgacagaaggctgggacgaggatggacatcattttgaggaa
tcattacactacgaaggaagggctgtagatataaccacctctgacagagataagagcaaa
tatggaatgttatccaggcttgcggtggaggcgggattcgactgggtcaattatgaatcc
aaagcccacattcattgttctgtgaaagcagaaaattctgtcgctgccaagtctggtgga
tgcttcccaggatcagcatcagttctcctcgaggatggtcgaaagaagctggtacaggaa
ctggagtttggcgacaaggtgttagctgcagacaaagaaggaaatatagtttccagtgat
ttcctcatgtttatagatcgagatacaacaacacggcgagagttttatgtttttgaaacg
gaaaagccaagtagaaagttaagactgacgccggcgcaccttgtctttgtcaccaataac
attaccgatagcgaaatgactgctgtgtttgccagtaatgtacagcctggtcaaagggtg
tttgttgtagacgaggcactaaatcgactgaaggcagtcactgtggaaaggatttacgtg
gaagaatacgagggttcatatgcccccataacctcgcaagggaccatcataattgatcat
gttctggcaagctgttacgcggtaatcgaagatcacaaatgggcgcactgggcattcgcg
ccagtcaggttgggtcacgcgctgatgtctttgacaggtctggtcaaggaacgcaaggac
ctccttcagagcgatggaatacactggtacaccgaagttctataccgcataggaacattg
ctgctggacaaaaactcatttcatccacttggcatgttacaaagttga

KEGG   Esox lucius (northern pike): 105027293
Entry
105027293         CDS       T04894                                 

Definition
(RefSeq) indian hedgehog B protein
  KO
K11989  indian hedgehog
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105027293
Peptidases and inhibitors [BR:els01002]
 Cysteine peptidases
  Family C46: hedgehog family
   105027293
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 LEAP-2 Vint
Other DBs
NCBI-GeneID: 105027293
NCBI-ProteinID: XP_010897635
UniProt: A0A3P9A203
LinkDB
AA seq 537 aa
MPISCGSRRGERSYSYSVPFGQQETPTQETPNLPAAGSIQRIRLNDCISCLSRTVALRME
DGVDRLTQYHIFFPLPPIPYPVGGTRSIRGEGVTSETTATCAAFPLRVGVPGPAGLGGMR
LSVLLGILIVCTLLLATVTEGCGPGRGHGKRRPPKKLTPLAYKQFSPNVAEKTLGASGRH
EGKITRNSERFKELTPNYNPDIIFKDEENTAADRLMTQRCKDKLNSLAISVMNMWPGVKL
RVTEGWDEDGHHSEDSLHYEGRAVDITTSDRDRIKYAMLARLAVEAGFDWVYYESKAHVH
CSVKSEHSVAAKTGGCFPGRSLVTLEDGSRKEVQDLQPGNRILASSESNASGELVYSEFI
TFLDRQPEARKQFYVLGTATGANLTLTAAHLVFATQGNCSAGSAVTRTMYASDVRPGQCV
LTAGPGAGTDQGPQVRLSPVVWVRVQVDTGAYAPLTQHGSLVVNGVLASCYAAMDQPQIA
HWAFEPLRLMYGWTGWSGSPQGGGLHWYPWVLHRIGTLLLDPGHFHPWGVATHDPER
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcccatatcttgtgggtcccgaagaggagaaagaagttacagttactccgtgccgttt
ggacaacaagagacaccgacgcaggaaacgccgaacttaccagccgccggttccatacaa
cgcattcggcttaatgactgcatttcttgtctctcacggacagttgctttgcgcatggaa
gatggcgtggacaggctgacacaatatcacatattcttccccctgccccccataccttac
cccgtggggggaacaaggagcatccggggggagggggtaactagtgaaaccacggcgacc
tgtgccgccttcccactccgcgttggagtgcccggccccgccggcctgggtgggatgcgg
ctctccgtgcttctggggatcctaatcgtctgcaccctgcttctcgcaactgtaactgag
ggttgtgggccggggaggggacacggcaagagacgtccgccgaaaaagctcacacccctt
gcttataagcagttcagcccaaacgttgcggagaagacactgggtgccagcggcagacac
gaagggaaaataacgagaaattcggaacgatttaaagagctaacaccaaactataaccct
gatataatatttaaggatgaggagaacaccgctgcggatcgactcatgacccagcgctgc
aaggacaagctgaactccctggctatctccgtgatgaacatgtggccaggggtgaagctg
agggtgacggagggctgggatgaggacggccaccactcggaggactccctccactatgag
ggcagagccgtggacatcaccacctcggaccgggaccggatcaaatacgccatgctggcc
cgactggctgtggaggccggtttcgactgggtctactacgagtccaaggcccacgtgcac
tgcagtgtcaagtcagagcactctgtggcggctaagacggggggctgcttccctggccgt
tctctggtcaccctggaggatgggagcaggaaggaggttcaggacctccagccagggaat
cgcatcctggcgtcctcggagtcaaacgccagcggcgagctcgtctacagcgagttcatc
accttcctagaccggcagcctgaagcgcggaagcagttctacgtgctgggaacggccacc
ggggccaacctgaccctcaccgccgcgcatctcgtgttcgcgactcaggggaactgctcg
gcggggtcggcggtcacgcggactatgtacgccagcgacgtgcggccgggacaatgtgtg
ctgacggctggcccaggggccgggacggaccaggggccacaggtccgtctgtcccccgtc
gtctgggtccgagtccaggtggacacgggggcgtacgccccgctgacacagcacggctcg
ctggtggtcaacggcgtcctggcatcgtgctacgctgctatggaccagccccagatagcc
cactgggccttcgagccgctccgcctgatgtacggctggacaggttggagtgggtccccg
cagggaggcggactacactggtacccctgggtcttacatcggataggaaccctcctactg
gacccgggacacttccacccctggggggtggcaacacacgaccctgagagataa

DBGET integrated database retrieval system