KEGG   Esox lucius (northern pike): 105013831Help
Entry
105013831         CDS       T04894                                 

Gene name
suv39h1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1 isoform X2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
els  Esox lucius (northern pike)
Pathway
els00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:els00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105013831 (suv39h1)
Enzymes [BR:els01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105013831 (suv39h1)
Chromosome and associated proteins [BR:els03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105013831 (suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    105013831 (suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo IncA
Motif
Other DBs
NCBI-GeneID: 105013831
NCBI-ProteinID: XP_010873938
LinkDB All DBs
AA seq 421 aa AA seqDB search
MFSFGGAEKMAEDLKGCSVSCKLSLDDLQAVCRRERLHCKQLRVNKHNFNDYEVEYLCDY
KKSKEEEFYLVKWKGYPESCNTWEPRKNLKCRKLMLQFHEDLEHEQRRQKRRTICPKRLD
KDVAWTLVEKAKLRQRLQQWEADLNKTRNHPGRIFVVNEVDLEGPPRDFTYINNYKVGDG
IVLNEMAVGCDCKDCFSDPVAGCCPGASLHRLAYTEKGQVRVRAGEPIYECNARCSCGPD
CPNRIVQNGIQLDLCIFKTGNGRGWGVRTLQHIRKNTFVMEYVGEIITSDEAEKRGHVYD
RQGATYLFDLDYVEDVYTVDAAHHGNISHFVNHSCNPNLQVYNVFIDNLDERLPRIALFS
TRSIRAGEELTFDYKMQIDPVDAESTKMDSNFSLAGLPSSPKKRIRVECRCGSDTCRKYL
F
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgttcagttttggcggtgcggaaaagatggcggaagatttgaaaggttgcagcgtatct
tgcaagctgtctttggatgatttgcaggcagtctgtcgacgggaaaggctccactgtaaa
cagctacgggtgaacaagcataacttcaatgattatgaagttgagtacctctgtgactac
aagaaatctaaggaggaggagttctacctagtcaaatggaagggctaccctgagtcgtgc
aacacctgggagccccgcaaaaacctaaagtgccggaagcttatgttacagttccacgag
gacttggagcatgagcagaggcggcagaagagacggaccatatgtcctaaaaggctagac
aaggatgtggcctggaccctggtagagaaagccaagcttcgtcagaggctccagcagtgg
gaggctgacctgaacaaaacacggaaccacccaggccgcatctttgttgtgaatgaggtg
gacctggaaggcccgccaagggacttcacctacatcaacaactacaaggtgggcgatggc
atcgttctcaatgagatggctgtgggctgtgactgtaaggactgcttcagtgatccggtg
gcaggctgctgcccgggggcctccctgcaccgcttggcctatactgagaagggccaggtg
cgagtgcgagccggggagcccatctatgaatgtaacgcccgctgcagctgcggacctgac
tgtcccaatcgcattgtccagaatggcattcagctagatctgtgcatcttcaagactggc
aatggccgaggctggggtgtgcgcacactacagcacattagaaagaacacctttgtcatg
gagtatgttggggagatcatcacgtcagacgaggcagaaaagagagggcacgtgtacgac
cggcagggtgccacctacctttttgacctggattatgttgaggatgtttatacagtggat
gccgctcaccatggcaacatctcccactttgtcaaccacagttgcaaccccaacctgcaa
gtatacaacgtgtttatagacaacctggatgaacgcctcccgagaatagctttattttca
acacgctccatcagggcaggagaagagctcacttttgactacaaaatgcaaattgatcct
gttgatgcagagagcacaaagatggactcaaatttcagtttagcgggactcccaagctct
cccaaaaagcgcattcgggtggagtgccggtgtggatctgacacatgtcgaaagtatctt
ttctga

DBGET integrated database retrieval system