KEGG   Esox lucius (northern pike): 105013989
Entry
105013989         CDS       T04894                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
els  Esox lucius (northern pike)
Pathway
els00220  Arginine biosynthesis
els00330  Arginine and proline metabolism
els01100  Metabolic pathways
els04020  Calcium signaling pathway
els04146  Peroxisome
els04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    105013989 (nos2)
   00330 Arginine and proline metabolism
    105013989 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105013989 (nos2)
   04020 Calcium signaling pathway
    105013989 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105013989 (nos2)
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     105013989 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 105013989
NCBI-ProteinID: XP_028975122
LinkDB
AA seq 1078 aa
MKLLDLDTKTTRQSPKSQKSRCALSIPVRNVKDGSTLYDSLHHQAVKKQPCTSKVCEGSL
MTPKALMPCPKDASLEILAQAIDLINQYYKSLKIPKTEEHKARLEEVENEINTTGTYQLT
LEELRFGAQHAWRNAPRCIGRIQWSNLQVFDARRCNTTKDMFQFLCEHLKFATNGGNIRS
AITVFPQRVDDRRDFRVWNSQLVKYAGYEMPDGSIQGDPSSVEFTKICMQLGWTPRYGLF
DVLPLVLQANGEDPDFYEIPPDLILEVCMEHPQYKWFQDLGLKWYVVPAVSNMLMEIGGL
QFPAAPFNGWYMGTEIGVRDFCDYQRYNILEEVGRRMGLETKKLSSLWKDQALVAINVAV
IYSFQKKKVTITDHHSVAESFIKHMETEFRLRGGCPADWVWLVPPMSGALSPIFHQEMVN
YILSPFFFYQPDPWTTHVWTNGKKTSSNKQISFKSLARAVLFSSTLMSRVLAKRVRCTVI
YATETGKSQTLAQRLNSMLNSAFNSRMLCMEDYNLSDMEQESLLVVVTSTFGNGDSPRNG
ESFKKQLFSLQSLGNKLWYCVFGLGSKMYPQFCAFAHAVDDKLEKLGAKRLTPTGEGDEL
NGQEEAFSAWALNMLKDAYKEFNIQNQLSQQLPEAERLFEVWDPLKYRVALESCTQDRIR
ALSSIHSKTIFPLKLKRRQNLQSQNSSFSTILVELEKEKSEDVLEFAPGDHVAVFPGNLP
QLVDGILKFLPHPPQTNQCLRLEYCSDTFLDDEKNWHTVRRIPACPLSQALTYFLDVTTP
PSQNLLHKLSQLTKQEEHHQRLLTLAKNSQEYIKWKTFRVPTFLEVLEEFPSLEPSAEFL
LSQLPLLKPRLYSISSSPQLHPNELHLTLTVVNYHTQEGQGPLHHGVCSTWLNTINEGDL
VPCFINSSNSFHLPAEPSTPVILVGAGSGIAPFRSFWQQRLYDMKQTGFSGGPMSLVFGC
KSSETDELYNEETLEMIRKGVLKSVTSTYSCQPGYPKLYVQDFLRDSMAEEVLSVLCQKE
GHLYVCGGVNMAQGVTLAVQEILSSQLGITLTQAGEYLAKLKIQKRYHEDIFGALFKK
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgaagttgcttgaccttgataccaaaacaactcgccagagtccgaaatctcaaaaaagc
aggtgtgccctttctatacctgtgcgtaatgtgaaggatggatcaactctctatgactct
ttgcatcaccaagcagtcaagaagcagccatgtacttcaaaagtctgtgaaggttctctc
atgactcccaaggctctaatgccttgtcccaaagacgcatctcttgagatcctagcccag
gctatagaccttatcaaccaatactacaagtccctcaaaattcccaaaacagaagaacac
aaggccagattggaggaagttgaaaatgagattaataccacaggaacatatcagttgact
ttggaagaactacggtttggtgctcaacatgcatggaggaatgccccaagatgcattggc
aggattcagtggtccaacttacaggtgtttgatgccagaaggtgcaacactaccaaggac
atgttccagtttctgtgtgaacacttaaagtttgccacaaatggaggaaacataaggtct
gcgatcacagtattcccccagagagtggatgaccggcgtgatttccgggtgtggaacagc
cagttggttaagtatgcaggttatgagatgcctgatggcagtatccagggagacccatcc
agtgtggaattcactaagatctgtatgcagcttggatggacaccacgctatgggcttttt
gatgtgttgccactggtcctgcaggccaatggggaggacccggatttttatgaaatccca
cctgacctgatcctggaggtttgcatggaacaccctcaatataagtggttccaagacttg
ggactgaagtggtatgttgtgccagcggtgtccaacatgctgatggagattggcggactt
caattccctgccgctccatttaatggctggtacatgggtacagagattggtgtcagggat
ttctgtgactatcagcgttataacatcttggaggaagtgggtcgtaggatgggcctggag
acaaaaaagctgtcctcactttggaaggaccaggccctggtggccatcaatgttgcagtc
atatacagttttcagaagaaaaaagtcactatcacagaccaccactctgtagcagagtcc
ttcatcaaacacatggaaacagagttccggctgcgtggcggctgccctgcagactgggtc
tggctggttccacccatgtcgggcgctctctcccccatcttccaccaggagatggtcaac
tacatcctctcacccttctttttctaccagcctgatccttggactactcatgtctggact
aatgggaagaaaacctcaagcaacaaacagatcagtttcaaatcacttgccagggctgtg
ctcttctcttcaactctcatgagcagagtgctggctaaaagggtgcgctgcactgtcatt
tatgccactgaaacaggcaaatcacagactttggcccaaagactgaactccatgctgaac
tctgccttcaactccaggatgctttgcatggaggactacaatctcagtgacatggaacag
gagagcctcctggttgtggtcacaagtacctttggcaatggagactcaccccgaaatgga
gagagtttcaagaagcagcttttctccttgcagtctctcgggaacaagttatggtactgt
gtgtttgggctgggatctaaaatgtacccgcaattctgtgcgtttgctcatgctgtggat
gacaagctggaaaagttgggggcaaagcggctgactcccacaggagagggggatgaactg
aatggacaggaggaggccttctctgcctgggctctcaacatgctaaaggatgcctataag
gagttcaacatccagaaccagctgagccagcagcttcctgaggcagaaagattgtttgag
gtctgggaccctttgaaataccgtgttgcactggagagctgcacccaggaccgcatcaga
gcactttcatccattcactctaaaacaatatttcccttgaaattgaagaggagacaaaat
ctgcaaagccaaaattcaagtttttccaccattctggtggagttggagaaggagaaaagt
gaagatgtcttggaattcgctccaggtgaccatgttgcggtttttccaggaaatctccct
caactggtggatgggatcctaaagttccttccccatccaccccaaactaaccagtgccta
cgactggaatactgctcagacactttcctagatgatgagaaaaactggcatactgtcaga
cgtatcccagcatgccctttgtctcaggcgctcacctactttctggatgtgaccacgccc
ccctctcagaatcttttacacaagctctctcagctgacaaaacaggaagaacaccaccag
cgtctgctgaccttagcaaagaactctcaggagtacataaagtggaagacattcagagtt
cccactttccttgaggtcctggaggagttcccttctttggaacccagcgcagaattccta
ctcagccagcttcccttgctcaagccccgcctctactctatcagctcctctccacagctc
caccccaatgagcttcatctcactttgacggtggtcaactatcacactcaagaaggacag
ggtcctcttcaccatggggtgtgcagcacatggttgaataccattaatgaaggagacctg
gtcccatgtttcatcaacagctcaaatagtttccaccttccagctgagcccagtactcca
gtcattctagtgggggctggcagtggcattgcacccttccgaagcttctggcagcaacgc
ctatatgacatgaaacaaacagggttttctggaggtcctatgagtcttgtttttggctgc
aagagctcagagacagatgagttatacaacgaagaaacactggagatgatacgtaaaggt
gtcttgaagagtgttacgtccacatactcctgtcagccgggttacccaaagttatatgtc
caggattttctgagggacagcatggcagaggaggtgctaagtgtgttgtgtcagaaggag
ggtcacctctatgtttgtgggggtgtgaacatggcccaaggagttactctagcagtacaa
gagatcctgagcagccaacttggcatcaccctcacccaggcaggagaatatctggccaaa
ctcaagattcagaagcggtaccatgaggacatttttggagccctgtttaagaagtga

DBGET integrated database retrieval system