KEGG   Esox lucius (northern pike): 105014106
Entry
105014106         CDS       T04894                                 

Gene name
ptch1
Definition
(RefSeq) protein patched homolog 1 isoform X1
  KO
K06225  patched 1
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105014106 (ptch1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 105014106
NCBI-ProteinID: XP_028980454
LinkDB
AA seq 1570 aa
MASAANVSSEQENRDPDRPRITRRNRGNNRTTALDLEYLQRPSYCDAAFALEQISEGKAT
GRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLRAANLETDMEKLWVE
VGGRVNQELKYTRQKMGEEAMFNSQLMIQTAQQEGANVLTVEALQQHLDSAIRASRVHVY
LFNRQWKLEHICYKSGELVTEAHIMDQIIEQLHPCLIITPLDCFWEGAKLQSGMAYLPGK
PPLQWTNFDPKEFLTELRAMNVQVDIWEEMLEKAGVAHGYMDRPCLNPRDPDCPLTAPNK
NTTKPFDVARILTGGCHGLSQKYMHWQEELIVGGTTKNGTGRLLRNLPTRTPGKPWQFGN
VSRMLRIAQALQTMFQLMTPKQMFEHRKGYDDVSHINWNEDKAAAILEAWQRKYSEVVHH
SVAANSSQKVLSFTTTTLEDIIKSFSDVSVIRVASGYLLMLAYACLTMLRWDCAKSQGAV
GLAGVLLVALSVAAGLGLCSLLGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNK
RIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVL
LIFPAILSMDLYRREDRRFDIFCCFYSPCANRVIQIEPHAYLDGVDGSRYNPPPTSYNPP
PTSYCTPPPTSYCTPPPSYSSHGFSQQTQITMQSTVQLRTEYDPRTQAFYTTAEPRSQIS
VQPFTPAPPGPANVGHGGRANSSQHAAHSSRSGCSGSRGNLNNSNVGRGSGSAAFPPPSP
SGAPPLSPHAREGVCVPGGSTSSHRDLLAQFGEASLGLRCPEPPCSRWTLASFAERHYAP
FLLQPTTKVVVILLFLVLLVVSLYGTTRVRDGLELTDIVPRETSEYDFIGAQFKFFSFYN
MYVVTQRAEYAQVQPLLYQLHQRFSTVRYILREDNGQLPRMWLHYFRDWLQGLQAAFDQD
WEAGRITQSSYSNGSDDGILAYKLLVQTGRRDKPINLNQLMRQRLVDADGIINPGAFYIY
LTAWVSNDPVAYAASQANIRPHPPDWHHDRTDSMPEIRLSIPAAEPIEYAQFPFYLNGLR
ETPQFVEAIESVRAICSNYSRQGLPSYPNGYPFLFWEQYVGLRHWLLLSISVVLACTFLV
CALFLLNPWTAGIIVLVLSLMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVAL
AFLTAIGDRNRRAVLALEHMFAPVLDGAFSTLLGVLMLAGSEFDFIVRYFFAVLAILTVL
GVLNGLVLLPVLLSYFGPYPEVTPVDGRSRLPTPSPNPPPHVVHFSVHPRRPTSGAGTGS
DSSDSEYSSNTTASGLSRELQQYQPTSSGARPGRAEEVQPDVQIGRSRAVRTEEVRLGAG
QRTVRHGDASAYSVSSSVPAESGVHPSVSRRFSKRDLQSPPPDHPRTDAFETATDAGSHP
TPTSHRERSAGPRARPSHNPRPNHHQPHHPYPAPTYCQPITTVTASASVTVAVHSAPLPN
QSPASSYPGHTAAESYHTAGAAEPAFQDPHVPLEVHMCRRRTKMDTSVESMELQDMECEA
AESDCGRGPS
NT seq 4713 nt   +upstreamnt  +downstreamnt
atggcctcggctgctaatgtctcctctgagcaggaaaacagggaccccgatcggccgagg
ataacgcggaggaacagggggaacaatcgcacaacagcgctggatttggagtatttgcag
cggccaagttactgcgatgccgcgttcgctttggagcaaatatctgagggaaaggcgact
ggaagaaaagcaccgctgtggctgagagcgaaatttcagagactcttgtttaagttgggc
tgttacatacaaaagaactgcggaaagtttttggttgtgggcctcttgatattcggagct
ttcgctgttggcttacgggcagctaatctggaaaccgacatggagaaactctgggtggaa
gtaggcggccgggtgaaccaggaactgaagtacacacgtcagaagatgggcgaggaggcc
atgttcaattcccagctgatgatccagacagcacagcaggagggcgctaacgtgctcact
gtggaggccctccaacaacacctggactcagctatcagggccagccgagtgcacgtttac
ctctttaacagacaatggaaattagaacatatatgctacaaatcaggagaacttgttact
gaagctcacattatggaccagattattgagcaactccacccctgtctcatcatcacgccc
ctggattgtttctgggagggagccaagctccagtctggaatggcctacctcccaggtaag
ccccctctgcagtggaccaactttgaccccaaggagtttctgacggagctccgggccatg
aacgtccaggtggacatctgggaggagatgctggagaaggctggggtggcccacggctac
atggaccgcccctgcctcaacccccgagaccccgactgtcccctcaccgcccccaacaag
aacaccaccaagcccttcgatgtggctcgtatcctgactggcggatgccacggcctctcc
cagaagtacatgcactggcaagaagagctgatcgtgggggggaccaccaagaatggcacc
ggacgactacttaggaatcttccaaccaggacgcccggaaaaccatggcaatttggcaat
gtctccagaatgttgaggattgcccaggcattacagaccatgttccagctcatgacccct
aagcagatgtttgagcaccggaagggctatgatgatgtgtcccatatcaactggaacgaa
gacaaggccgcagccatactggaggcatggcagaggaagtactctgaggtggttcaccac
agcgtggcagccaactcgtctcagaaggttttgtcgtttactaccaccaccctggaagac
atcatcaagtcattctctgatgtcagcgtcatacgtgtcgccagtggctacctgctcatg
ctggcctatgcctgtctgaccatgctccgctgggactgtgccaagtcgcagggagctgta
ggactggccggtgtcctcttggtggcgctgtctgtggcggcaggcctggggctctgttct
ctgctgggcatatctttcaatgcagccaccacacaggtgctaccgttcttggctctaggc
gtgggtgtggacgatgtgtttcttctggcccatgctttcagtgaaaccggacaaaacaag
aggatcccctttgaggaccgtacaggggagtgtttgaagaggacaggagcgagtgtggct
ctcacttccatcagtaacgtcactgctttcttcatggcagctctcatccccatacctgct
ctaagagccttctctcttcaggccgcggtggtggtggtgtttaactttgccatggtgctg
ctcatcttccctgccatcctcagtatggatctgtatcgcagagaggaccgccgctttgac
atcttctgctgcttttacagtccgtgtgctaacagggttatccagatcgagccccatgcc
tacctagacggagtggacggcagtcgctacaacccccctcccacctcctacaacccccct
cccacctcctactgcaccccccctcctacctcctactgcaccccccctccctcctacagc
agccacggtttctcccagcagacccagatcaccatgcagtccacggttcagctgcggaca
gagtacgacccccggacccaggccttctacaccaccgctgaacccaggtctcagatctct
gtccaacccttcaccccggcgccccccggccccgccaacgtaggccatgggggtcgcgcc
aacagtagccagcacgccgcacattccagccggagcgggtgtagcggcagtcgcggcaac
ctcaacaacagcaacgtcggccgagggtccggttcggccgcgttcccgcccccatccccc
tccggtgccccccccttgtccccccacgcacgcgagggcgtgtgcgtgcccggggggagt
accagctcccacagggacctgctggcccagtttggggaggcctccctgggtctccgctgt
ccagagccgccctgctcccggtggaccctggcctcttttgctgagagacactacgccccc
ttcctactgcagccgaccaccaaggtggtggtcatcctgctgttcctggtcctgctggtg
gtcagcctgtacgggaccacccgggtgcgagacggcctggagctgaccgatatcgtcccc
cgggagaccagcgagtacgacttcatcggggcccagttcaagttcttctccttctacaac
atgtacgtggtgacccagcgggcggagtacgcccaggtgcagcctcttctctaccagctc
caccagcgcttcagcacagtgcgctacatcctgagggaggacaacggacagcttccccgc
atgtggctccactacttcagggactggctgcaaggtctgcaggcagcgttcgaccaggac
tgggaggctggtcggatcacacagagcagctacagtaacggttctgacgacggcatcctg
gcctacaaactactagtacagacaggacgcagggacaagcccattaacttaaaccagctg
atgaggcaacgcttggtagatgcagatggcattatcaacccgggggcattttatatctac
ctgacggcatgggtcagcaacgacccagtggcatacgccgcctcacaggccaacatccgg
ccacaccccccagactggcaccacgaccgcacagactcgatgcctgagatacgcctcagc
attccagccgcagagccaatcgaatacgcacagtttcccttctacctcaacgggctccgc
gagaccccccagtttgtggaggccatcgagtcagtgcgagccatctgcagcaactacagc
cgccagggcctgcccagctaccccaacggctaccctttcctgttctgggagcagtacgta
ggcctgcgacactggcttctgctctccatcagcgtggtactggcgtgcaccttcctcgtc
tgtgccctcttcctcctcaacccctggactgccggcatcatcgtgctggtcttgtccctg
atgaccgtggagctgttcggtatgatgggcctcattgggatcaagctcagcgccgtgccc
gtggttatcctgatcgcctccgtcggcatcggggtggagttcaccgtccacgtggctctg
gcgttcctcacagcgataggggaccgtaaccggcgggcggtgctggcgttagaacatatg
tttgcaccggtgttggacggagccttctccaccctgctgggagtcctcatgctggcgggc
tccgagtttgacttcatcgtcaggtatttcttcgctgtgctggccatcctgaccgtgctg
ggggtcctgaacggactggtcctcctcccggtgttgctgtcttacttcggcccctaccca
gaggtgacccctgtggatgggcgtagccggctgccgaccccgtcccccaatcccccgcct
cacgtggtccacttctcggtgcacccccgccgccccacctccggggcggggacgggttcc
gactcgtccgattccgagtacagctccaacaccacggcgtcgggcctcagccgggagctg
cagcagtaccagcccacctccagtggagccaggcccgggagagcagaggaggtgcaaccg
gacgtacagatcggccggagcagggccgtcaggacagaggaggtgcgactgggagcgggg
cagaggacagtaaggcatggagacgcctctgcctactctgtttcttcttcggttccggcg
gagtcaggagtccaccctagtgtatcccgtcgcttcagcaagagggacttacagtcaccc
ccaccggaccacccacgcacagatgctttcgaaaccgctaccgatgccggaagccatccc
acccccaccagccacagagaacgctcggcggggccaagggcccgcccttcccacaacccc
cggcccaatcaccaccaacctcaccacccttaccctgcccccacatactgccagcccata
accacggtaacagcgtccgcgtcagtcaccgtggccgtccactccgcccccctccccaat
cagagccccgcctcctcttacccgggacacactgcagcggaaagttaccacacagcgggg
gccgcggaacctgcttttcaggacccccacgtgccactggaggttcatatgtgccgcaga
agaaccaagatggacaccagtgtggagtccatggagcttcaggacatggagtgtgaggca
gctgagagcgactgtggcagggggccaagctga

KEGG   Esox lucius (northern pike): 105022690
Entry
105022690         CDS       T04894                                 

Gene name
ptch2
Definition
(RefSeq) protein patched homolog 2
  KO
K11101  patched 2
Organism
els  Esox lucius (northern pike)
Pathway
els04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    105022690 (ptch2)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 105022690
NCBI-ProteinID: XP_010889643
UniProt: A0A3P8Y5Y3
LinkDB
AA seq 1477 aa
MLLYSVLDYCRFCRIRTVCLLLRSLLRFLVWTMASDLRVPGAGVFGVLPPSYTRSPPPVN
SDVLRRPSYCHAAFALKQISKGKAVGQKAPLWIRARFQALLFSLGCHIQRHCGKVLFIGL
LVFGALSVGLRVAAIETDIEQLWVEAGSRVSRELRYTKEKQGEESVFTSQMLIQTPKQEG
TNVLTQDALLLHMEAALSASKVQVSLFGKSWDLNKICYKSGVPIIENVMIERMIDKLFPC
MIVTPLDCFWEGAKLQGGSAYLPGMPDIQWMNLDPLKLMEELSQFTSLEGFREMLDKAQV
GHAYMDRPCLDPNDPDCPHSAPNKDLGESPDIAGRLQGGCHGFSKKFMHWQEELILGGRI
KDTQNALQSAKALQTMFLLMSPKQLYEHFKDDYEIHDINWNEDKATAILESWQRKFVDVA
HGSIPQNSTSKIHAFSTTTLNDIMKSFSDVSVIRVAGGYLLMLAYACVTMLRWDCAKSQG
AVGLAGVLLVALSVAAGLGLCSLLGLSFNAATTQVLPFLALGIGVDDMFLLAHSFTEAGV
NIPFKERTGDCLRRTGTSVALTSINNMTAFFMAALVPIPALRAFSLQAAIIVVFNFAMVL
LIFPAILSLDLHRREDKRLDILCCFYSPCSSRVIHIQPQEFSDANDNATGRATASQTTTT
YTGSTITTSTQITTTVQAFTQCDAAGQHIVTILPPTSQISTSPPSVVVASSPAPPSPTDP
YGSQLFTPSSSTRDLLAQVDETKEARECVPLPFFRWNLSSFARDKYAPLLLKPESKVVVV
VLFVSLLGLSLYGTTMVHDGLYLTDIVPRDTKEYDFIDAQFKYFSFYNMYLVTMDGFDYA
RSQRLLIQLHNSFNSVKFVVRDGNQQLPRMWLHYFQDWLLGLQAAFDADWEAGRITRDSY
RNGTEDGVLAYKLLIQTGSKKEPFNYSQLASRRLLDEDGLIYPEVFYIYLTVWVSNDPLG
YAASQANFYPHPREWIHDKYDTTGENLRIPAAEPLEFAQFPFYLNGLRQASDFIEGIESV
RAICEEFTRKGVLNYPNGYPFLFWEQYIGLRHWFLLAVSVVLACTFLVCAILLLNPWTAG
IIVFILAMMTVELFGIMGLIGIKLSAIPVVILIASVGIGVEFTVHIALGFLTAIGNRNKR
SAVALEHMFAPVIDGAISTLLGVLMLAGSEFDFILRYFFAVLAILTVLGILNGLVLLPVL
LSLVGPPPEVSPTDDSSHLASPSPEPLPPPMTHHGYYAGQGRRRQAFSESSDSEYYSETT
GTSGIGEDDYKYCDRSSYSAPPTSRILLEASENPSFPRLTVVKPFGEGAGITARRELLNE
SLPSAVNSFGSRLVSDQGARTQHLPSDRTQGPGRTNHCAPRSQTNRGPHQSRTKGPTYSG
GAAPGSAVTTTVTATASVTVAVHPSLPGAYQGYMHEGYEDNESDCSEDTKRTSQCYGKEP
RSSKRESLELQDLEYVQNQHQGKQAQGGPQIQAAKDC
NT seq 4434 nt   +upstreamnt  +downstreamnt
atgctcttgtattctgtattggattattgtcgcttttgcagaattcgcactgtttgtctc
ttgcttcgctctttgcttcgttttcttgtttggactatggcctcggatctcagagtccca
ggggccggtgtttttggagttttacccccaagttatacgcgttctccgccgccagtgaac
tcagatgttctccggagacccagttattgccacgctgctttcgcattaaaacagatttca
aaggggaaggctgtgggtcagaaagccccgttgtggattcgggcgcggttccaggctctt
ctcttttctttgggctgtcacatccagcgacattgtggaaaagtccttttcattggactg
cttgtgtttggtgccttgtctgtgggtttgcgggtcgctgccattgagacggacatcgag
caactgtgggtggaagctggaagccgggtgagccgggaactacgctacaccaaggagaag
cagggagaggaatccgtgttcacgtcccagatgctcatacaaactcccaaacaggaaggc
accaacgttctgacccaagatgctttacttcttcacatggaggcagcgctctcggccagc
aaggtccaggtgtctctgtttggaaagtcgtgggatcttaataaaatctgctacaaatct
ggagttcctatcatagaaaatgtcatgatcgaaaggatgattgacaagctgtttccctgt
atgattgttacaccgctggactgtttctgggaaggcgcaaagctccagggcgggtcagca
tacttaccggggatgcctgacatccagtggatgaacctggaccctctgaagctgatggag
gagctgagccagttcaccagtctggaaggcttcagggagatgctggacaaggctcaggtg
ggccacgcctacatggaccgcccctgcctggaccccaacgaccccgactgtccccacagc
gcgcccaacaaggacctaggagagagtcccgacattgccgggcggctccaaggtggttgc
cacggattctccaagaagttcatgcactggcaggaggagctgatcctcggtggtcggatc
aaggacacccagaatgctttgcagagtgccaaggctctccagaccatgtttctcctcatg
agccccaagcagctctacgagcactttaaggacgactacgagatccatgacatcaactgg
aacgaggacaaggccaccgccatcctggagtcctggcagaggaagttcgttgacgtggct
catggtagtatcccccagaactccacgtcgaagatccacgccttttccacaaccaccctc
aacgacatcatgaagtccttctccgatgtcagtgttatccgggtggctggaggctacttg
ctcatgctggcgtacgcctgcgtgaccatgctccgttgggactgtgccaagtcccaggga
gccgtggggctggccggcgtgctcctggtggccctgtcagtggcggctggtctggggctg
tgctccctgctgggtctgtccttcaacgccgccaccacacaggttcttcccttcctggct
ctggggatcggtgtggatgacatgttcctcctggcccactcattcacagaggctggcgtc
aacatcccctttaaggagaggacgggggactgcctcaggaggactggcaccagcgtggcg
ctcacctccatcaacaacatgacggccttcttcatggctgccctggttcccatcccagca
ctgcgcgccttctccctgcaggcagctattattgtggtgttcaacttcgccatggtgctc
ctcatcttcccggccatcctgagtcttgacctgcatcgccgggaggacaagcgcttggat
atcctgtgctgcttctacagcccctgctcatcccgcgttatccacatccagccgcaggag
ttctccgacgccaacgacaacgccaccggccgcgcgaccgcctcccagaccaccaccacc
tacacaggctccaccattaccaccagcacccagatcaccaccaccgtccaggccttcacc
cagtgcgacgcggcgggccagcacatagtcaccatcctccccccgacctcccagatctcc
accagccccccctccgtggtggtggcctcgtcccccgctcccccgtcccccaccgacccg
tacggctcccagctgttcaccccatccagctccacccgcgacctcctggctcaggtggac
gagaccaaggaggcccgggagtgcgtcccgctcccgttcttccgctggaacctgtccagc
ttcgcccgggacaagtatgcgccgctcctcctgaagccggagagcaaggtggtcgtggtg
gtcctgttcgtgtctctgctgggcctcagcctgtatgggacgaccatggtccatgacggc
ctctacctgacagacattgtgcctcgcgacaccaaggagtatgacttcatcgatgcccag
ttcaagtacttctccttctacaatatgtacctggtgaccatggacggcttcgactacgcc
cggtcgcagcgcctcctcatccagctgcacaactccttcaactcggtcaagttcgtggtg
agggacggcaaccagcagctgccccggatgtggttgcactatttccaggactggcttctg
ggactacaggctgcctttgacgcggactgggaagcaggccggatcactcgggacagctac
cgcaatgggaccgaggatggtgttctagcctacaagcttctcatccagaccggctccaag
aaggaacctttcaactacagccagctggcttcacgtcgcctgcttgatgaggatggtctg
atttacccggaggtcttctacatctacctgacggtgtgggtgagcaatgaccctctgggc
tacgcagcgtcacaggctaacttctaccctcacccccgcgagtggatccatgacaagtac
gacaccactggagagaacctacgcatccccgcggccgagcccctggagtttgcgcagttc
cctttctacctgaacggcctgcggcaggcttccgacttcatcgaggggatcgagagcgtg
cgcgccatctgcgaggagttcacccggaagggagtgctcaactaccccaacgggtacccc
ttcctgttttgggagcagtacatcggcctgcgccactggttcctcctggctgtcagtgtg
gtgttggcgtgcacgttcctggtctgtgccatcctcctgctcaacccctggaccgccggc
atcatcgtcttcatcctggccatgatgacagtggagttgttcggtatcatgggcctgatc
ggcatcaagctcagcgccatcccggtggtgatcctcattgcctcagtgggcatcggcgtc
gagtttaccgtccacatcgcgctgggcttcctgacggccatcggcaacaggaacaagcgt
tccgcggtggccctggagcacatgttcgcccctgtgattgacggggccatctccactctt
ctgggcgtgctcatgctggccggctccgagttcgacttcatcctgaggtacttcttcgcg
gtgctggccatcctgaccgtgctggggatcctgaatggactggtgctcctgcccgtgctg
ctctccctcgtgggcccgccacccgaggtctcgccgaccgacgacagcagccacctcgcc
agcccgtcgcccgagcccctccctcctcccatgacccaccacggttactacgcggggcaa
ggccggcgccggcaggcgttctcggagtcctccgactcggagtactactcggagacgacc
ggcacgtcgggaataggcgaggacgactacaagtactgtgaccgcagttcctacagcgcc
cctcccacctcccgtatactgctggaggctagcgagaaccccagcttccccaggctaacg
gtggtcaagcctttcggagagggcgccggcataaccgcccggagagaactcttaaacgaa
tctttgccgagtgcggtgaactcattcggctctcggctggtgtctgaccagggagccagg
acgcaacatttacccagtgacaggacccaaggtcctgggaggactaaccactgcgctccc
aggtctcagaccaacagagggcctcatcagagcaggactaaggggccgacctatagcggt
ggcgcggcgcccgggagcgcggtcactacaacggtgacggccacagcctctgtgacggta
gcggtccaccccagtctgcctggggcttaccaaggctacatgcacgaaggctatgaggac
aatgagtcagactgttctgaggacactaagaggacttcacagtgttacgggaaagagcct
cggtcttccaagcgtgaatccttggagctccaagacctggaatatgtacagaaccaacat
caagggaaacaggcacaaggtggcccacagatccaggcagccaaagattgctag

DBGET integrated database retrieval system